TRIM5 alpha Antibody - BSA Free

Western Blot: TRIM5 alpha Antibody [NBP3-35889] - Western blot analysis of various lysates using TRIM5 alpha Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM5 alpha Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM5 alpha (NP_149083.2).
  
  Sequence:
  EKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TRIM5 alpha Antibody - BSA Free

• EC 6.3.2
• EC 6.3.2.-
• RING finger protein 88
• RNF88tripartite motif protein TRIM
• TRIM5alpha
• tripartite motif containing 5
• tripartite motif protein TRIM5
• tripartite motif-containing 5
• tripartite motif-containing protein 5

Background

TRIM5-alpha is a protein that is found in the cells of many mammals and fends of various retrovirus infections. It protects monkeys from infection with HIV-1, and humans from infection with some other viruses. If a retrovirus has entered a cell, it needs to shed its capsid in order to reversely transcribe its genes, so that they can be expressed by the host cell. It is believed that TRIM5 alpha, which is present in the cytoplasm, somehow recognizes the capsid and blocks its shedding, thereby stopping the virus in its tracks. It thus represents an intracellular defense completely separate from the rest of the body's immune system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM5