TRIM2 Antibody

Images

 
Immunohistochemistry: TRIM2 Antibody [NBP1-81505] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TRIM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
TRIM2 Protein (NBP1-81505PEP)

Alternate Names for TRIM2 Antibody

  • KIAA0517tripartite motif protein 2
  • RING finger protein 86
  • RNF86tripartite motif protein TRIM2
  • tripartite motif containing 2
  • tripartite motif-containing 2
  • tripartite motif-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP1-19596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45788
Species: Hu
Applications: WB, IHC
NBP2-37969
Species: Hu
Applications: IHC, IHC-P
NBP2-43685
Species: Hu
Applications: WB
NBP2-19474
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM2 Antibody (NBP1-81505) (0)

There are no publications for TRIM2 Antibody (NBP1-81505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM2 Antibody (NBP1-81505) (0)

There are no reviews for TRIM2 Antibody (NBP1-81505). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM2 Antibody (NBP1-81505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TRIM2 Antibody (NBP1-81505)

Discover related pathways, diseases and genes to TRIM2 Antibody (NBP1-81505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM2 Antibody (NBP1-81505)

Discover more about diseases related to TRIM2 Antibody (NBP1-81505).
 

Pathways for TRIM2 Antibody (NBP1-81505)

View related products by pathway.

PTMs for TRIM2 Antibody (NBP1-81505)

Learn more about PTMs related to TRIM2 Antibody (NBP1-81505).

Blogs on TRIM2

There are no specific blogs for TRIM2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our TRIM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM2

Customers Who Bought This Also Bought