TRIM2 Antibody

Images

 
Immunohistochemistry: TRIM2 Antibody [NBP1-81505] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TRIM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
TRIM2 Protein (NBP1-81505PEP)

Alternate Names for TRIM2 Antibody

  • KIAA0517tripartite motif protein 2
  • RING finger protein 86
  • RNF86tripartite motif protein TRIM2
  • tripartite motif containing 2
  • tripartite motif-containing 2
  • tripartite motif-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
MAB18251
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP1-19596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2574
Species: Hu
Applications: ICFlow
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45788
Species: Hu
Applications: WB, IHC
NBP2-37969
Species: Hu
Applications: IHC, IHC-P
NBP2-43685
Species: Hu
Applications: WB
NBP2-19474
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM2 Antibody (NBP1-81505) (0)

There are no publications for TRIM2 Antibody (NBP1-81505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM2 Antibody (NBP1-81505) (0)

There are no reviews for TRIM2 Antibody (NBP1-81505). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM2 Antibody (NBP1-81505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TRIM2 Antibody (NBP1-81505)

Discover related pathways, diseases and genes to TRIM2 Antibody (NBP1-81505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM2 Antibody (NBP1-81505)

Discover more about diseases related to TRIM2 Antibody (NBP1-81505).
 

Pathways for TRIM2 Antibody (NBP1-81505)

View related products by pathway.

PTMs for TRIM2 Antibody (NBP1-81505)

Learn more about PTMs related to TRIM2 Antibody (NBP1-81505).

Blogs on TRIM2

There are no specific blogs for TRIM2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TRIM2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81505 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought