TRIM14 Antibody

Images

 
Western Blot: TRIM14 Antibody [NB110-40872] - Jurkat Whole Cell, concentration 2.5 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

TRIM14 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14. Peptide Sequence TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
Use in Immunohistochemistry-paraffin reported in scientific literature (PMID:29867201).
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
Jurkat Whole Cell Lysate
Publications
Read Publication using
NB110-40872 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29867201).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Purity
Protein A purified

Alternate Names for TRIM14 Antibody

  • KIAA0129tripartite motif-containing 14
  • tripartite motif containing 14
  • tripartite motif protein TRIM14
  • tripartite motif-containing protein 14

Background

The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32588
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4708
Species: Hu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-32500
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-47365
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1483
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
NBP1-90171
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-83180
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF4940
Species: Hu, Mu
Applications: ICC
NBP1-85311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94462
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00051127-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
NB100-1214
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-40872
Species: Hu, Mu
Applications: WB, IHC

Publications for TRIM14 Antibody (NB110-40872)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TRIM14 Antibody (NB110-40872) (0)

There are no reviews for TRIM14 Antibody (NB110-40872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM14 Antibody (NB110-40872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional TRIM14 Products

Diseases for TRIM14 Antibody (NB110-40872)

Discover more about diseases related to TRIM14 Antibody (NB110-40872).
 

Pathways for TRIM14 Antibody (NB110-40872)

View related products by pathway.

PTMs for TRIM14 Antibody (NB110-40872)

Learn more about PTMs related to TRIM14 Antibody (NB110-40872).
 

Research Areas for TRIM14 Antibody (NB110-40872)

Find related products by research area.

Blogs on TRIM14

There are no specific blogs for TRIM14, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM14
Entrez