TRIM13 Antibody

Images

 
Western Blot: TRIM13 Antibody [NBP2-88466] - WB Suggested Anti-RFP2 Antibody Titration: 0.125ug/ml. ELISA Titer: 1:62500. Positive Control: Human Lung
Immunohistochemistry-Paraffin: TRIM13 Antibody [NBP2-88466] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml.
Western Blot: TRIM13 Antibody [NBP2-88466] - Host: Rabbit. Target Name: TRIM13. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1ug/ml
Immunohistochemistry: TRIM13 Antibody [NBP2-88466] - Human Lung
Immunohistochemistry: TRIM13 Antibody [NBP2-88466] - Human kidney

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

TRIM13 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM13. Peptide sequence: DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM13
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TRIM13 Antibody

  • B-cell chronic lymphocytic leukemia tumor suppressor Leu5
  • CLL-associated RING finger
  • E3 ubiquitin-protein ligase TRIM13
  • EC 6.3.2.-
  • LEU5CAR
  • Leukemia-associated protein 5
  • Putative tumor suppressor RFP2
  • Ret finger protein 2RING finger protein 77
  • RFP2DLEU5
  • RNF77Leu5
  • tripartite motif containing 13
  • tripartite motif protein 13
  • tripartite motif-containing 13
  • Tripartite motif-containing protein 13

Background

Ret finger protein 2 This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 6. Multiple alternatively spliced transcript variants have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant RFP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM13 Antibody (NBP2-88466) (0)

There are no publications for TRIM13 Antibody (NBP2-88466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM13 Antibody (NBP2-88466) (0)

There are no reviews for TRIM13 Antibody (NBP2-88466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM13 Antibody (NBP2-88466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM13 Products

Research Areas for TRIM13 Antibody (NBP2-88466)

Find related products by research area.

Blogs on TRIM13

There are no specific blogs for TRIM13, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM13