Orthogonal Strategies: Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Analysis in human skin and skeletal muscle tissues using NBP1-88192 antibody. Corresponding CXADR RNA-seq data are presented for ...read more
Orthogonal Strategies: Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXADR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
WB, ICC/IF reported in scientific literature (PMID: 26076477). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Reactivity reported in scientific literature (PMID: 24498395), Mouse reactivity reported in the scientific literature (PMID: 26076477).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for CXADR Antibody
CAR10Coxsackievirus B-adenovirus receptor
CAR4/6
coxsackie virus and adenovirus receptor
coxsackie virus B receptor
coxsackievirus and adenovirus receptor
CVB3 binding protein
CVB3 BP
CVB3-binding protein
CXADR
HCAR
HCVADR
Background
Coxsackie Adenovirus Receptor is encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for CXADR Antibody (NBP1-88192)
Discover related pathways, diseases and genes to CXADR Antibody (NBP1-88192). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CXADR Antibody (NBP1-88192)
Discover more about diseases related to CXADR Antibody (NBP1-88192).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CXADR Antibody and receive a gift card or discount.