CXADR Antibody


Western Blot: CXADR Antibody [NBP1-88192] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-140
Immunocytochemistry/ Immunofluorescence: CXADR Antibody [NBP1-88192] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining in human rectum and skeletal muscle tissues using anti-CXADR antibody. Corresponding CXADR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CXADR Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
Specificity of human CXADR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
CXADR Protein (NBP1-88192PEP)
Read Publications using
NBP1-88192 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%). Reactivity reported in scientific literature (PMID: 24498395)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CXADR Antibody

  • CAR10Coxsackievirus B-adenovirus receptor
  • CAR4/6
  • coxsackie virus and adenovirus receptor
  • coxsackie virus B receptor
  • coxsackievirus and adenovirus receptor
  • CVB3 binding protein
  • CVB3 BP
  • CVB3-binding protein
  • hCAR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP, DirELISA
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC

Publications for CXADR Antibody (NBP1-88192)(3)

Reviews for CXADR Antibody (NBP1-88192) (0)

There are no reviews for CXADR Antibody (NBP1-88192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CXADR Antibody (NBP1-88192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CXADR Antibody (NBP1-88192)

Discover related pathways, diseases and genes to CXADR Antibody (NBP1-88192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXADR Antibody (NBP1-88192)

Discover more about diseases related to CXADR Antibody (NBP1-88192).

Pathways for CXADR Antibody (NBP1-88192)

View related products by pathway.

Research Areas for CXADR Antibody (NBP1-88192)

Find related products by research area.

Blogs on CXADR

There are no specific blogs for CXADR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CXADR Antibody and receive a gift card or discount.


Gene Symbol CXADR