CXADR Antibody

Images

 
Orthogonal Strategies: Western Blot: CXADR Antibody [NBP1-88192] - Analysis in human cell lines Caco-2 and MCF-7. Corresponding CXADR RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: CXADR Antibody [NBP1-88192] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining in human rectum and skeletal muscle tissues using anti-CXADR antibody. Corresponding CXADR RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: CXADR Antibody [NBP1-88192] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CXADR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS
Specificity
Specificity of human CXADR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CXADR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 26076477). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control Peptide
Publications
Read Publications using
NBP1-88192 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%). Reactivity reported in scientific literature (PMID: 24498395), Mouse reactivity reported in the scientific literature (PMID: 26076477).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CXADR Antibody

  • CAR10Coxsackievirus B-adenovirus receptor
  • CAR4/6
  • coxsackie virus and adenovirus receptor
  • coxsackie virus B receptor
  • coxsackievirus and adenovirus receptor
  • CVB3 binding protein
  • CVB3 BP
  • CVB3-binding protein
  • CXADR
  • HCAR
  • HCVADR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC

Publications for CXADR Antibody (NBP1-88192)(3)

Reviews for CXADR Antibody (NBP1-88192) (0)

There are no reviews for CXADR Antibody (NBP1-88192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CXADR Antibody (NBP1-88192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CXADR Products

Bioinformatics Tool for CXADR Antibody (NBP1-88192)

Discover related pathways, diseases and genes to CXADR Antibody (NBP1-88192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXADR Antibody (NBP1-88192)

Discover more about diseases related to CXADR Antibody (NBP1-88192).
 

Pathways for CXADR Antibody (NBP1-88192)

View related products by pathway.

Research Areas for CXADR Antibody (NBP1-88192)

Find related products by research area.

Blogs on CXADR

There are no specific blogs for CXADR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXADR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CXADR