Basalin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Basalin Antibody [NBP1-80806] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & nuclear membrane.
Immunohistochemistry-Paraffin: Basalin Antibody [NBP1-80806] - Staining of human kidney.
Immunohistochemistry: Basalin Antibody [NBP1-80806] - Staining of hair shows strong cytoplasmic positivity in cells in internal root sheath .
Independent Antibodies: Immunohistochemistry-Paraffin: Basalin Antibody [NBP1-80806] - Staining of human cerebral cortex, kidney, lymph node and skin, hairy using Anti-TCHHL1 antibody NBP1-80806 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Basalin Antibody [NBP1-80806] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Basalin Antibody [NBP1-80806] - Staining of human lymph node.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Basalin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTSETQEKECETKDLPVQYGSRN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCHHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Basalin Protein (NBP1-80806PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Basalin Antibody

  • basalin
  • intermediate filament-associated protein
  • Protein S100-A17
  • S100 calcium binding protein A17
  • S100 calcium-binding protein A17
  • S100A17
  • THHL1
  • trichohyalin-like 1
  • trichohyalin-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051360-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-93477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00028986-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-37892
Species: Hu
Applications: IHC, IHC-P
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB9080
Species: Hu
Applications: WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
NBP2-54626
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IP, WB
NBP1-33610
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Basalin Antibody (NBP1-80806) (0)

There are no publications for Basalin Antibody (NBP1-80806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Basalin Antibody (NBP1-80806) (0)

There are no reviews for Basalin Antibody (NBP1-80806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Basalin Antibody (NBP1-80806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Basalin Products

Bioinformatics Tool for Basalin Antibody (NBP1-80806)

Discover related pathways, diseases and genes to Basalin Antibody (NBP1-80806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Basalin

There are no specific blogs for Basalin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Basalin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCHHL1
Entrez