Recombinant Human TRIB1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIB1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 91-191 of Human TRIB1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIB1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIB1 Protein

  • C8FWG-protein-coupled receptor induced protein
  • GIG-2
  • GIG2G-protein-coupled receptor-induced protein 2
  • G-protein-coupled receptor-induced gene 2 protein
  • SKIP1
  • TRB-1
  • TRB1phosphoprotein regulated by mitogenic pathways
  • tribbles homolog 1 (Drosophila)
  • tribbles homolog 1
  • tribbles-like protein 1

Background

TRIB1 - tribbles homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48030
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for TRIB1 Partial Recombinant Protein (H00010221-Q01) (0)

There are no publications for TRIB1 Partial Recombinant Protein (H00010221-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIB1 Partial Recombinant Protein (H00010221-Q01) (0)

There are no reviews for TRIB1 Partial Recombinant Protein (H00010221-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIB1 Partial Recombinant Protein (H00010221-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIB1 Products

Bioinformatics Tool for TRIB1 Partial Recombinant Protein (H00010221-Q01)

Discover related pathways, diseases and genes to TRIB1 Partial Recombinant Protein (H00010221-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIB1 Partial Recombinant Protein (H00010221-Q01)

Discover more about diseases related to TRIB1 Partial Recombinant Protein (H00010221-Q01).
 

Pathways for TRIB1 Partial Recombinant Protein (H00010221-Q01)

View related products by pathway.

PTMs for TRIB1 Partial Recombinant Protein (H00010221-Q01)

Learn more about PTMs related to TRIB1 Partial Recombinant Protein (H00010221-Q01).
 

Research Areas for TRIB1 Partial Recombinant Protein (H00010221-Q01)

Find related products by research area.

Blogs on TRIB1

There are no specific blogs for TRIB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHREBP Antibody
NB400-135
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIB1