TREX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-89202] - Staining of human colon shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-89202] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-89202] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-89202] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TREX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TREX1 Antibody - BSA Free (NBP1-89202) is a polyclonal antibody validated for use in IHC and WB. Anti-TREX1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TREX1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID 28325644).
• Control Peptide:

  TREX1 Protein (NBP1-89202PEP)

Reactivity Notes

Mouse (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TREX1 Antibody - BSA Free

• 3'-5' exonuclease TREX1
• AGS1
• Aicardi-Goutieres syndrome 1
• CRV
• DKFZp434J0310
• DNase III
• DRN3
• EC 3.1.11.2
• HERNS
• three prime repair exonuclease 1,3' repair exonuclease 1

Background

TREX1 encodes the major 3'->5' DNA exonuclease in human cells. The protein is a non-processive exonuclease that may serve a proofreading function for a human DNA polymerase. It is also a component of the SET complex, and acts to rapidly degrade 3' ends of nicked DNA during granzyme A-mediated cell death. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, and Cree encephalitis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TREX1 Antibody (NBP1-89202)(1)

Publication using NBP1-89202

• Sakai T, Miyazaki T, Shin DM et al. DNase-active TREX1 frame-shift mutants induce serologic autoimmunity in mice. J. Autoimmun 2017-03-18 [PMID: 28325644] (WB, Human)

FAQs for TREX1 Antibody (NBP1-89202). (Showing 1 - 1 of 1 FAQ).

1. Is there any possibility that Trex1 expression is detected in cells from WT mouse on immunocytochemistry staining?
   • Unfortunately, we have not yet validated this antibody in mouse, so I do not have much information as to how it may or may not detect the mouse protein vs. the human protein. The sequence used to generate this antibody is 80% homologous to the mouse sequence, so there is definitely a chance of detection possible.

Bioinformatics

• Gene Symbol: TREX1