| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TREX1 Antibody - BSA Free (NBP1-89202) is a polyclonal antibody validated for use in IHC and WB. Anti-TREX1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TREX1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID 28325644). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-89202 | Applications | Species |
|---|---|---|
| Sakai T, Miyazaki T, Shin DM et al. DNase-active TREX1 frame-shift mutants induce serologic autoimmunity in mice. J. Autoimmun 2017-03-18 [PMID: 28325644] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for TREX1 Antibody (NBP1-89202)Find related products by research area.
|
|
Dinosaur Protein Names: Infographic Trex1 the protein is involved in DNA damage response. Tyrannosaurus rex (T. rex) the dinosaur lived during the Cretaceous Period. Raptor the protein is a regulator of mTOR activity. Velociraptors the dinosaurs lived during the Cretaceous Period. Learn... Read full blog post. |
|
Trex1 (3'-5' exonuclease TREX1, DNase III) This gene encodes the major 3' to 5' DNA exonuclease in human cells. The protein is a non-processive exonuclease that appears to provide proofreading for checkpoint signaling after DNA damage in response to oxidative stress and apoptosis. It is ubiqui... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TREX1 |