TREX1 Antibody

Images

 
Immunohistochemistry-Paraffin: TREX1 Antibody [NBP1-89202] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TREX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TREX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 28325644).
Control Peptide
TREX1 Protein (NBP1-89202PEP)
Publications
Read Publication using
NBP1-89202 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28325644).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TREX1 Antibody

  • 3'-5' exonuclease TREX1
  • AGS1
  • Aicardi-Goutieres syndrome 1
  • CRV
  • DKFZp434J0310
  • DNase III
  • DRN3
  • EC 3.1.11.2
  • HERNS
  • three prime repair exonuclease 1,3' repair exonuclease 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88053
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76978
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-56902
Species: Hu
Applications: WB, ICC/IF
NBP2-03285
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP1-91968
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-82775
Species: Hu
Applications: WB, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow

Publications for TREX1 Antibody (NBP1-89202)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TREX1 Antibody (NBP1-89202) (0)

There are no reviews for TREX1 Antibody (NBP1-89202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TREX1 Antibody (NBP1-89202). (Showing 1 - 1 of 1 FAQ).

  1. Is there any possibility that Trex1 expression is detected in cells from WT mouse on immunocytochemistry staining?
    • Unfortunately, we have not yet validated this antibody in mouse, so I do not have much information as to how it may or may not detect the mouse protein vs. the human protein. The sequence used to generate this antibody is 80% homologous to the mouse sequence, so there is definitely a chance of detection possible.

Secondary Antibodies

 

Isotype Controls

Additional TREX1 Products

Bioinformatics Tool for TREX1 Antibody (NBP1-89202)

Discover related pathways, diseases and genes to TREX1 Antibody (NBP1-89202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TREX1 Antibody (NBP1-89202)

Discover more about diseases related to TREX1 Antibody (NBP1-89202).
 

Pathways for TREX1 Antibody (NBP1-89202)

View related products by pathway.

PTMs for TREX1 Antibody (NBP1-89202)

Learn more about PTMs related to TREX1 Antibody (NBP1-89202).
 

Research Areas for TREX1 Antibody (NBP1-89202)

Find related products by research area.

Blogs on TREX1.

Dinosaur Protein Names: Infographic
Trex1 the protein is involved in DNA damage response. Tyrannosaurus rex (T. rex) the dinosaur lived during the Cretaceous Period. Raptor the protein is a regulator of mTOR activity. Velociraptors the dinosaurs lived during the Cretaceous Period. Learn...  Read full blog post.

Trex1 (3'-5' exonuclease TREX1, DNase III)
This gene encodes the major 3' to 5' DNA exonuclease in human cells. The protein is a non-processive exonuclease that appears to provide proofreading for checkpoint signaling after DNA damage in response to oxidative stress and apoptosis. It is ubiqui...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TREX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TREX1