TRERF1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TRERF1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRERF1.
  
  

  Source: E. coli

  Amino Acid Sequence: PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TRERF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56238.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRERF1 Recombinant Protein Antigen

• BCAR2
• Breast cancer estrogen resistance 2RAPAHSA277276
• dJ139D8.5
• FLJ21198
• rapa-1
• rapa-2
• RP1-139D8.5
• transcriptional regulating factor 1
• transcriptional regulating protein 132
• transcriptional-regulating factor 1
• Transcriptional-regulating protein 132
• TREP132
• TReP-132
• Zinc finger protein rapa
• Zinc finger transcription factor TReP-132

Background

The transcriptional regulating protein of 132 kDa (TReP-132/TRERF1) was identified as a transcription factor that interacts with and activates the promoter of the CYP11A1 gene, a gene that encodes cytochrome P450 side chain cleavage (P450scc) and catalyzes the first step in steroidgenesis. TRep-132 can function as a nuclear receptor co-activator and has been shown to interact with Sp1 and the progesterone receptor (PR) to suppress growth via activation of the gene promoters of the cyclin-dependent kinase inhibitors, p21 and p27.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRERF1