TREML2/TLT-2 Antibody - BSA Free

Western Blot: TREML2/TLT-2 Antibody [NBP1-70737] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TREML2/TLT-2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TREML2(triggering receptor expressed on myeloid cells-like 2) The peptide sequence was selected from the middle region of TREML2. Peptide sequence TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TREML2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TREML2/TLT-2 Antibody - BSA Free

• C6orf76
• dJ238O23.1
• FLJ13693
• MGC149715
• MGC149716
• TLT2
• TLT-2
• TREML2
• trem-like transcript 2 protein
• triggering receptor expressed on myeloid cells-like 2
• triggering receptor expressed on myeloid cells-like protein 2
• UNQ6268/PRO20473

Background

TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TREML2