TREML2/TLT-2 Antibody


Western Blot: TREML2/TLT-2 Antibody [NBP1-70737] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TREML2/TLT-2 Antibody Summary

Synthetic peptides corresponding to TREML2(triggering receptor expressed on myeloid cells-like 2) The peptide sequence was selected from the middle region of TREML2. Peptide sequence TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TREML2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TREML2/TLT-2 Antibody

  • C6orf76
  • dJ238O23.1
  • FLJ13693
  • MGC149715
  • MGC149716
  • TLT2
  • TLT-2
  • TREML2
  • trem-like transcript 2 protein
  • triggering receptor expressed on myeloid cells-like 2
  • triggering receptor expressed on myeloid cells-like protein 2
  • UNQ6268/PRO20473


TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1294 AY358171.1 2-1295 1295-3758 AL133404.8 7920-10383


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, KO
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ICC
Species: Hu
Applications: Flow, AgAct, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for TREML2/TLT-2 Antibody (NBP1-70737) (0)

There are no publications for TREML2/TLT-2 Antibody (NBP1-70737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREML2/TLT-2 Antibody (NBP1-70737) (0)

There are no reviews for TREML2/TLT-2 Antibody (NBP1-70737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TREML2/TLT-2 Antibody (NBP1-70737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TREML2/TLT-2 Products

Bioinformatics Tool for TREML2/TLT-2 Antibody (NBP1-70737)

Discover related pathways, diseases and genes to TREML2/TLT-2 Antibody (NBP1-70737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TREML2/TLT-2 Antibody (NBP1-70737)

Discover more about diseases related to TREML2/TLT-2 Antibody (NBP1-70737).

Pathways for TREML2/TLT-2 Antibody (NBP1-70737)

View related products by pathway.

Blogs on TREML2/TLT-2

There are no specific blogs for TREML2/TLT-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TREML2/TLT-2 Antibody and receive a gift card or discount.


Gene Symbol TREML2