Trappin-2/Elafin/Skalp Antibody - BSA Free

Western Blot: Skalp Antibody [NBP1-62538] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Trappin-2/Elafin/Skalp Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PI3(peptidase inhibitor 3, skin-derived (SKALP)) The peptide sequence was selected form the middle region of PI3. Peptide sequence KGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAM. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PI3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Trappin-2/Elafin/Skalp Antibody - BSA Free

• cementoin
• Elafin
• Elastase-specific inhibitor
• ESI
• ESIWAP four-disulfide core domain protein 14
• Peptidase inhibitor 3
• peptidase inhibitor 3, skin-derived
• PI3
• PI-3
• pre-elafin
• protease inhibitor 3, skin-derived (SKALP)
• Protease inhibitor WAP3
• SKALP
• SKALPELAFIN
• Skin-derived antileukoproteinase
• Trappin2
• Trappin-2
• WAP four-disulfide core domain 14
• WAP3MGC13613
• WFDC14elafin

Background

PI3 is an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. PI3 contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. PI3 belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.This gene encodes an elastase-specific inhibitor, which contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PI3
• OMIM:
  • NP_002629(Human)
• Uniprot:
  • P19957()