TRAP220/MED1 Antibody (3F6)

Images

 
ELISA: TRAP220/MED1 Antibody (3F6) [H00005469-M06] - Detection limit for recombinant GST tagged PPARBP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRAP220/MED1 Antibody (3F6) Summary

Immunogen
PPARBP (NP_004765 1391 a.a. - 1490 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP
Specificity
PPARBP (3F6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MED1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRAP220/MED1 Antibody (3F6)

  • Activator-recruited cofactor 205 kDa component
  • ARC205
  • CRSP1TRIP2
  • CRSP200p53 regulatory protein RB18A
  • DRIP230
  • DRIP230PPAR-binding protein
  • MBD4
  • MED1
  • mediator complex subunit 1DRIP205
  • mediator of RNA polymerase II transcription subunit 1
  • PBPPPARGBP
  • Peroxisome proliferator-activated receptor-binding protein
  • PPAR binding protein
  • PPARBP
  • PPARBPMGC71488
  • PPARG binding protein
  • PPARGBP
  • RB18ATR-interacting protein 2
  • Thyroid hormone receptor-associated protein complex 220 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP220
  • thyroid receptor interacting protein 2
  • Thyroid receptor-interacting protein 2
  • TRAP220
  • TRAP220TRIP-2
  • TRIP2
  • vitamin D receptor-interacting protein 230 kD
  • Vitamin D receptor-interacting protein complex component DRIP205

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005469-M06
Species: Hu
Applications: WB, ELISA

Publications for TRAP220/MED1 Antibody (H00005469-M06) (0)

There are no publications for TRAP220/MED1 Antibody (H00005469-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAP220/MED1 Antibody (H00005469-M06) (0)

There are no reviews for TRAP220/MED1 Antibody (H00005469-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAP220/MED1 Antibody (H00005469-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAP220/MED1 Products

Bioinformatics Tool for TRAP220/MED1 Antibody (H00005469-M06)

Discover related pathways, diseases and genes to TRAP220/MED1 Antibody (H00005469-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAP220/MED1 Antibody (H00005469-M06)

Discover more about diseases related to TRAP220/MED1 Antibody (H00005469-M06).
 

Pathways for TRAP220/MED1 Antibody (H00005469-M06)

View related products by pathway.

PTMs for TRAP220/MED1 Antibody (H00005469-M06)

Learn more about PTMs related to TRAP220/MED1 Antibody (H00005469-M06).
 

Research Areas for TRAP220/MED1 Antibody (H00005469-M06)

Find related products by research area.

Blogs on TRAP220/MED1

There are no specific blogs for TRAP220/MED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAP220/MED1 Antibody (3F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MED1
Entrez
OMIM
Uniprot