TRAP alpha Antibody


Western Blot: TRAP alpha Antibody [NBP1-86912] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Immunocytochemistry/ Immunofluorescence: TRAP alpha Antibody [NBP1-86912] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.
Western Blot: TRAP alpha Antibody [NBP1-86912] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TRAP alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Specificity of human, mouse, rat TRAP alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
TRAP alpha Lysate (NBP2-65452)
Control Peptide
TRAP alpha Protein (NBP1-86912PEP)
Read Publications using
NBP1-86912 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TRAP alpha Antibody

  • DKFZp781N23103
  • FLJ14232
  • FLJ22100
  • FLJ23034
  • FLJ78242
  • FLJ93042
  • signal sequence receptor, alpha
  • SSR alpha subunit
  • SSR-alpha
  • translocon-associated protein alpha subunit
  • translocon-associated protein subunit alpha
  • TRAP alpha
  • TRAP-alpha
  • TRAPASignal sequence receptor subunit alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TRAP alpha Antibody (NBP1-86912)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for TRAP alpha Antibody (NBP1-86912) (0)

There are no reviews for TRAP alpha Antibody (NBP1-86912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAP alpha Antibody (NBP1-86912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TRAP alpha Products

Bioinformatics Tool for TRAP alpha Antibody (NBP1-86912)

Discover related pathways, diseases and genes to TRAP alpha Antibody (NBP1-86912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAP alpha Antibody (NBP1-86912)

Discover more about diseases related to TRAP alpha Antibody (NBP1-86912).

Pathways for TRAP alpha Antibody (NBP1-86912)

View related products by pathway.

Research Areas for TRAP alpha Antibody (NBP1-86912)

Find related products by research area.

Blogs on TRAP alpha

There are no specific blogs for TRAP alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRAP alpha Antibody and receive a gift card or discount.


Gene Symbol SSR1