TRAP alpha Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex, liver, lymph node and pancreas using Anti-SSR1 antibody NBP1-86912 (A) shows similar ...read more
Independent Antibodies: Western Blot: TRAP alpha Antibody [NBP1-86912] - Analysis using Anti-SSR1 antibody NBP1-86912 (A) shows similar pattern to independent antibody NBP1-87815 (B).
Immunocytochemistry/ Immunofluorescence: TRAP alpha Antibody [NBP1-86912] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human cerebral cortex.
Western Blot: TRAP alpha Antibody [NBP1-86912] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human liver.
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human pancreas.
Immunohistochemistry-Paraffin: TRAP alpha Antibody [NBP1-86912] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, Rt, CeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

TRAP alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAP alpha Protein (NBP1-86912PEP)
Publications
Read Publications using
NBP1-86912 in the following applications:

  • 2 publications
  • WB
    2 publications

Reactivity Notes

C. elegans reactivity reported in scientific literature (Li et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAP alpha Antibody

  • DKFZp781N23103
  • FLJ14232
  • FLJ22100
  • FLJ23034
  • FLJ78242
  • FLJ93042
  • signal sequence receptor, alpha
  • SSR alpha subunit
  • SSR-alpha
  • translocon-associated protein alpha subunit
  • translocon-associated protein subunit alpha
  • TRAP alpha
  • TRAP-alpha
  • TRAPASignal sequence receptor subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69471
Species: Hu
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-32174
Species: Hu
Applications: ICC/IF, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, Simple Western, WB
D6050
Species: Hu
Applications: ELISA
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-22605
Species: V
Applications: ELISA, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NBP2-75529
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-85466
Species: Fe, Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for TRAP alpha Antibody (NBP1-86912)(5)

We have publications tested in 3 confirmed species: Human, Rat, C. elegans.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(2)
WB
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
C. elegans
(2)
All Species
Showing Publications 1 - 5 of 5.
Publications using NBP1-86912 Applications Species
Li X, Itani O, Haataja L et al. Requirement for TRanslocon-Associated Protein (TRAP) alpha in insulin biogenesis: Figures S1-S7 and Table S1 bioRxiv Jan 27 2019 (WB, C. elegans) WB C. elegans
Taylor MS, Ruch TR, Hsiao PY et al. Architectural Organization of the Metabolic Regulatory Enzyme Ghrelin O-Acyltransferase. J Biol Chem 2013 Nov 8 [PMID: 24045953] (ICC/IF, Human) ICC/IF Human
Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013 Apr [PMID: 23435261]
Li X, Itani O, Haataja L et al. Requirement for TRanslocon-Associated Protein (TRAP) alpha in insulin biogenesis bioRxiv Jan 27 2019 (WB, Rat) WB Rat
Li S, Lin Q, Shao X, et al. Requirement for translocon-associated protein (TRAP) alpha in insulin biogenesis Sci Adv Dec 1 2019 [PMID: 31840061] (ICC/IF, C. elegans) ICC/IF C. elegans

Reviews for TRAP alpha Antibody (NBP1-86912) (0)

There are no reviews for TRAP alpha Antibody (NBP1-86912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAP alpha Antibody (NBP1-86912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRAP alpha Products

Bioinformatics Tool for TRAP alpha Antibody (NBP1-86912)

Discover related pathways, diseases and genes to TRAP alpha Antibody (NBP1-86912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAP alpha Antibody (NBP1-86912)

Discover more about diseases related to TRAP alpha Antibody (NBP1-86912).
 

Pathways for TRAP alpha Antibody (NBP1-86912)

View related products by pathway.

Research Areas for TRAP alpha Antibody (NBP1-86912)

Find related products by research area.

Blogs on TRAP alpha

There are no specific blogs for TRAP alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAP alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSR1