SSR2 Antibody - BSA Free

Western Blot: SSR2 Antibody [NBP1-69471] - This Anti-SSR2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.

Immunohistochemistry: SSR2 Antibody [NBP1-69471] - Staining of human Muscle.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

SSR2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SSR2(signal sequence receptor, beta (translocon-associated protein beta)) The peptide sequence was selected from the N terminal of SSR2. Peptide sequence SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSR2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for SSR2 Antibody - BSA Free

• DKFZp686F19123
• Signal sequence receptor subunit beta
• signal sequence receptor, beta (translocon-associated protein beta)
• SSR-beta
• TLAP
• translocon-associated protein beta
• translocon-associated protein subunit beta
• TRAP-beta
• TRAPBTRAP-BETA

Background

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2).The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SSR2 Antibody (NBP1-69471)(2)

Publications using NBP1-69471

• Liu Y, Cao J, Pu Ys Et Al. RP11-874J12.4, a novel lncRNA, confers chemoresistance in human gastric cancer cells by sponging miR-3972 and upregulating SSR2 expression American journal of translational research 2021-06-15 [PMID: 34306333] (WB)
• Losfeld ME, Ng BG, Kircher M et al. A new congenital disorder of glycosylation caused by a mutation in SSR4, the signal sequence receptor 4 protein of the TRAP complex. Hum Mol Genet. 2013-11-13 [PMID: 24218363] (WB, Human)

Review for SSR2 Antibody (NBP1-69471) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Marie-estelle LOSFELD WB Human 02/27/2014

Summary

• Application: Western Blot
• Sample Tested: human dermal fibroblasts
• Species: Human
• Lot: qc15371

Bioinformatics

• Gene Symbol: SSR2
• Uniprot:
  • P43308(Human)