SSR2 Antibody


Western Blot: SSR2 Antibody [NBP1-69471] - This Anti-SSR2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: SSR2 Antibody [NBP1-69471] - Staining of human Muscle.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SSR2 Antibody Summary

Synthetic peptides corresponding to SSR2(signal sequence receptor, beta (translocon-associated protein beta)) The peptide sequence was selected from the N terminal of SSR2. Peptide sequence SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSA
This product is specific to Subunit or Isoform: beta.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-69471 in the following applications:

Read Publication using
NBP1-69471 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SSR2 Antibody

  • DKFZp686F19123
  • Signal sequence receptor subunit beta
  • signal sequence receptor, beta (translocon-associated protein beta)
  • SSR-beta
  • TLAP
  • translocon-associated protein beta
  • translocon-associated protein subunit beta
  • TRAP-beta


The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2).The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SSR2 Antibody (NBP1-69471)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for SSR2 Antibody (NBP1-69471) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-69471:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot SSR2 NBP1-69471
reviewed by:
Marie-estelle LOSFELD
WB Human 02/27/2014


ApplicationWestern Blot
Sample Testedhuman dermal fibroblasts


Blocking Details5% milk in TBS tween

Primary Anitbody

Dilution Ratio1/500 incubation 3h RT in 5% milk in TBS-tween

Secondary Antibody

Secondary Descriptionanti-Rabbit IgG HRP from amersham
Secondary Concentration1/5000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSR2 Antibody (NBP1-69471) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SSR2 Products

Bioinformatics Tool for SSR2 Antibody (NBP1-69471)

Discover related pathways, diseases and genes to SSR2 Antibody (NBP1-69471). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSR2 Antibody (NBP1-69471)

Discover more about diseases related to SSR2 Antibody (NBP1-69471).

Pathways for SSR2 Antibody (NBP1-69471)

View related products by pathway.

Blogs on SSR2.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Marie-estelle LOSFELD
Application: WB
Species: Human


Gene Symbol SSR2