Transglutaminase 1/TGM1 Antibody - BSA Free

Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Transglutaminase 1/TGM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Transglutaminase 1/TGM1 Antibody - BSA Free (NBP3-25206) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Transglutaminase 1/TGM1 using the following amino acid sequence: DLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLD
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Transglutaminase 1/TGM1 Antibody - BSA Free

• Epidermal TGase
• ICR2
• KTG
• LI
• LI1
• LI1EC 2.3.2.13
• protein-glutamine gamma-glutamyltransferase K
• protein-glutamine-gamma-glutamyltransferase)
• TG(K)
• TGASE
• TGase-1
• TGK
• TGKTGase K
• TGM1
• transglutaminase 1 (K polypeptide epidermal type I
• Transglutaminase 1
• Transglutaminase K
• transglutaminase, keratinocyte
• transglutaminase-1

Background

Tissue transglutaminase is a calcium activated enzyme which catalyzes the cross linking of proteins and the conjugation of polyamines to proteins. The identification of transglutaminase as the main antigen of endomysium antibodies allows a new diagnostic approach to celiac disease (CD). CD, a genetic, immunologically mediated small bowel enteropathy that causes malabsorption, is one of the more common disorders in Western countries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TGM1