Transferrin Recombinant Protein Antigen

Images

 
There are currently no images for Transferrin Protein (NBP1-87222PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Transferrin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TF.

Source: E. coli

Amino Acid Sequence: DGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87222. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Transferrin Recombinant Protein Antigen

  • Beta-1 metal-binding globulin
  • DKFZp781D0156
  • EC 3.4.21
  • PRO1557
  • PRO2086
  • Serotransferrin
  • Siderophilin
  • TF
  • Transferrin

Background

Transferrin is a single polypeptide chain glycoprotein and is a member of the iron binding family of proteins. It has a molecular weight of 77 kDa and a serum concentration range of 1800 to 2700 mg/L. It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+. The iron is transported in blood and interstitial fluids to sites of use and disposal. Iron/transferrin is essential in haemoglobin synthesis and for certain types of cell division. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. The function of transferrin is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. In addition to its function in iron transport, this protein may also have a physiologic role as granulocyte/pollen binding protein (GPBP) involved in the removal of certain organic matter/allergins from serum.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MEP00B
Species: Mu
Applications: ELISA
DHAPG0
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
DY1707
Species: Hu
Applications: ELISA
DTFP10
Species: Hu
Applications: ELISA
NB120-10109
Species: Hu
Applications: CyTOF-ready, IHC,  IHC-P, S-ELISA, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-87222PEP
Species: Hu
Applications: AC

Publications for Transferrin Protein (NBP1-87222PEP) (0)

There are no publications for Transferrin Protein (NBP1-87222PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transferrin Protein (NBP1-87222PEP) (0)

There are no reviews for Transferrin Protein (NBP1-87222PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Transferrin Protein (NBP1-87222PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Transferrin Products

Research Areas for Transferrin Protein (NBP1-87222PEP)

Find related products by research area.

Blogs on Transferrin.

Transferrin: "Ironing" out the Details of Cellular Anemia
Transferrin is a protein found in the blood plasma, a glycoprotein that is specific for controlling free iron in the bodies' biological fluids. Transferrin has two binding sites that are specific for very tight and reversible iron binding. The binding...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Transferrin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TF