TRAFD1 Antibody

Images

 
Western Blot: TRAFD1 Antibody [NBP1-80008] - Raji cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: TRAFD1 Antibody [NBP1-80008] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAFD1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human TRAFD1. Peptide sequence TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAFD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TRAFD1 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRAFD1 Antibody

  • FLN29FLN29 gene product
  • Protein FLN29
  • TRAF-type zinc finger domain containing 1
  • TRAF-type zinc finger domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-26506
Species: Hu, Mu, Rt
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68833
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
AF3155
Species: Mu
Applications: WB, IHC
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IP, B/N, Flow-CS
AF4019
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
7270-IL/CF
Species: Hu
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-61849
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRAFD1 Antibody (NBP1-80008) (0)

There are no publications for TRAFD1 Antibody (NBP1-80008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAFD1 Antibody (NBP1-80008) (0)

There are no reviews for TRAFD1 Antibody (NBP1-80008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAFD1 Antibody (NBP1-80008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRAFD1 Antibody (NBP1-80008)

Discover related pathways, diseases and genes to TRAFD1 Antibody (NBP1-80008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAFD1 Antibody (NBP1-80008)

Discover more about diseases related to TRAFD1 Antibody (NBP1-80008).
 

Pathways for TRAFD1 Antibody (NBP1-80008)

View related products by pathway.

Blogs on TRAFD1

There are no specific blogs for TRAFD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAFD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAFD1
Uniprot