TRADD Antibody - BSA Free

Immunohistochemistry: TRADD Antibody [NBP2-68918] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRADD Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRVLQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRADD
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  TRADD Recombinant Protein Antigen (NBP2-68918PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for TRADD Antibody - BSA Free

• MGC11078
• TNFRSF1A-associated via death domainTNFR1-associated DEATH domain protein
• TRADD
• tumor necrosis factor receptor type 1 associated death domain protein
• tumor necrosis factor receptor type 1-associated DEATH domain protein
• tumor necrosis factor receptor-1-associated protein

Background

TRADD [tumor necrosis factor receptor type 1-associated (TNFR1) death domain protein] is a death domain containing adaptor molecule that interacts with TNFR1/TNFRSF1A and mediates programmed cell death signaling and NF-kB activation (reviewed in Feng, 2005). TRADD binds adaptor protein TRAF2, reduces the recruitment of inhibitor-of-apoptosis proteins (IAPs) by TRAF2, and thereby suppresses TRAF2 mediated apoptosis. TRADD can also interact with receptor TNFRSF6/FAS and adaptor protein FADD/MORT1, and is involved in the Fas-induced cell death pathway. This antibody recognizes TRADD; human TRADD is a 312 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRADD