TPT1/TCTP Antibody (9H7S4)

Western Blot: TPT1/TCTP Antibody (9H7S4) [NBP3-16122] - Western blot analysis of extracts of various cell lines, using TPT1/TCTP Rabbit mAb (NBP3-16122) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: TPT1/TCTP Antibody (9H7S4) [NBP3-16122] - Immunohistochemistry of paraffin-embedded rat brain using TPT1/TCTP Rabbit mAb (NBP3-16122) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: TPT1/TCTP Antibody (9H7S4) [NBP3-16122] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug TPT1/TCTP antibody (NBP3-16122). Western blot was performed from the immunoprecipitate using TPT1/TCTP antibody (NBP3-16122) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clone: 9H7S4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TPT1/TCTP Antibody (9H7S4) Summary

• Description: Novus Biologicals Rabbit TPT1/TCTP Antibody (9H7S4) (NBP3-16122) is a recombinant monoclonal antibody validated for use in IHC, WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPT1/TCTP (P13693). MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TPT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TPT1/TCTP Antibody (9H7S4)

• FLJ27337
• Fortilin
• Histamine-releasing factor
• HRF
• p02
• p23
• TCTP
• TCTPHRFfortilin
• TPT1
• translationally-controlled tumor protein
• tumor protein, translationally-controlled 1

Background

Histamine is an inflammatory mediator that is ubiquitously expressed and has a broad range of pharmacologic effects. Specifically, it plays a role in the central nervous, gastrointestinal, respiratory and immune systems. Histamine release is mediated by the stimulation of mast cells and basophils. Histamine-releasing factor (HRF) is a cytokine-like molecule that causes the release of histamine, IL-4 and IL-13 from basophils as well as the secretion of IL-8 and a calcium response in eosinophils. HRF belongs to the translationally controlled tumor protein (TCTP) family and is detected as a protein of 21 kDa in mice and 23 kDa in human. It is expressed in several healthy and tumoral cells, including erythrocytes, hepatocytes, macrophages, platelets, keratinocytes, erythroleukemia cells, gliomas, melanomas, hepatoblastomas and lymphomas, and it is localized in the cytoplasm. HRF plays a pivotal role in allergic diseases, and due to its wide distribution in brain, is thought to be involved in neurodegenerative disorders, such as Alzheimer's disease and Down Syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPT1