FKBP52/FKBP4 Antibody (5C11)

Images

 
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in Raw 264.7.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11 Analysis of FKBP4 expression in HeLa.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in PC-12.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunoprecipitation: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FKBP4 MaxPab rabbit ...read more
Sandwich ELISA: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
5C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FKBP52/FKBP4 Antibody (5C11) Summary

Immunogen
FKBP4 (AAH07924 301 a.a. - 410 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Specificity
FKBP4 - FK506 binding protein 4, 59kDa
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FKBP4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.
Publications
Read Publications using H00002288-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FKBP52/FKBP4 Antibody (5C11)

  • 51 kDa FK506-binding protein
  • 52 kDa FKBP
  • 59 kDa immunophilin
  • EC 5.2.1.8
  • FK506 binding protein 4, 59kDa
  • FK506-binding protein 4 (59kD)
  • FK506-binding protein 4
  • FKBP4
  • FKBP-4
  • FKBP51
  • FKBP52
  • FKBP-52
  • FKBP52T-cell FK506-binding protein, 59kD
  • FKBP59
  • FKBP5952 kDa FK506-binding protein
  • HBI
  • HSP binding immunophilin
  • Hsp56
  • HSP-binding immunophilin
  • Immunophilin FKBP52
  • p52
  • p59
  • peptidyl-prolyl cis-trans isomerase FKBP4
  • peptidylprolyl cis-trans isomerase
  • PPIase FKBP4
  • PPIase
  • rotamase

Background

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. This gene has been found to have multiple polyadenylation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for FKBP4/FKBP52 Antibody (H00002288-M01)(2)

Reviews for FKBP4/FKBP52 Antibody (H00002288-M01) (0)

There are no reviews for FKBP4/FKBP52 Antibody (H00002288-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP4/FKBP52 Antibody (H00002288-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FKBP52/FKBP4 Products

Bioinformatics Tool for FKBP4/FKBP52 Antibody (H00002288-M01)

Discover related pathways, diseases and genes to FKBP4/FKBP52 Antibody (H00002288-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP4/FKBP52 Antibody (H00002288-M01)

Discover more about diseases related to FKBP4/FKBP52 Antibody (H00002288-M01).
 

Pathways for FKBP4/FKBP52 Antibody (H00002288-M01)

View related products by pathway.

PTMs for FKBP4/FKBP52 Antibody (H00002288-M01)

Learn more about PTMs related to FKBP4/FKBP52 Antibody (H00002288-M01).
 

Research Areas for FKBP4/FKBP52 Antibody (H00002288-M01)

Find related products by research area.

Blogs on FKBP52/FKBP4

There are no specific blogs for FKBP52/FKBP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FKBP52/FKBP4 Antibody (5C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP4
Entrez
OMIM
Uniprot