Recombinant Human TP53TG1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TP53TG1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 90 of Human TP53AP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMLGSLAPDPGSRRHSGQAALRPRRYPTLWDRCRKRWLRPIFTQLLAAGLAYHTLLPIPSEPLFAAPGEHLHQCFVKESYCPPRVLAKEQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TP53TG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TP53TG1 Protein

  • LINC00096
  • NCRNA00096
  • P53TG1
  • P53TG1-D
  • TP53 target 1 (non-protein coding)
  • TP53AP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF2065
Species: Mu
Applications: WB, Simple Western, IHC, ICC
7270-IL/CF
Species: Hu
NBP2-66840
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30876
Species: Hu
Applications: IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
H00011257-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TP53TG1 Recombinant Protein (H00011257-P01) (0)

There are no publications for TP53TG1 Recombinant Protein (H00011257-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TP53TG1 Recombinant Protein (H00011257-P01) (0)

There are no reviews for TP53TG1 Recombinant Protein (H00011257-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TP53TG1 Recombinant Protein (H00011257-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for TP53TG1 Recombinant Protein (H00011257-P01)

Discover related pathways, diseases and genes to TP53TG1 Recombinant Protein (H00011257-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TP53TG1 Recombinant Protein (H00011257-P01)

Discover more about diseases related to TP53TG1 Recombinant Protein (H00011257-P01).
 

Pathways for TP53TG1 Recombinant Protein (H00011257-P01)

View related products by pathway.

PTMs for TP53TG1 Recombinant Protein (H00011257-P01)

Learn more about PTMs related to TP53TG1 Recombinant Protein (H00011257-P01).

Blogs on TP53TG1

There are no specific blogs for TP53TG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF
p19ARF Antibody
NB200-106
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TP53TG1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53TG1