TOP2B Antibody

Images

 
Western Blot: TOP2B Antibody [NBP1-89527] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TOP2B Antibody [NBP1-89527] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows moderate nuclear positivity.
Western Blot: TOP2B Antibody [NBP1-89527] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Simple Western: TOP2B Antibody [NBP1-89527] - Simple Western lane view shows a specific band for TOP2B in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Simple Western: TOP2B Antibody [NBP1-89527] - Electropherogram image(s) of corresponding Simple Western lane view. TOP2B antibody was used at 1:100 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOP2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOP2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:100
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
TOP2B Protein (NBP1-89527PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-89527 in the following applications:

Publications
Read Publication using
NBP1-89527 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26439921).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOP2B Antibody

  • antigen MLAA-44
  • DNA topoisomerase 2-beta
  • DNA topoisomerase II beta
  • DNA topoisomerase II, 180 kD
  • DNA topoisomerase II, beta isozyme
  • EC 5.99.1.3
  • TOP2B
  • top2beta
  • TOPIIB
  • topo II beta
  • topoisomerase (DNA) II beta (180kD)
  • topoisomerase (DNA) II beta 180kDa
  • topoisomerase II beta
  • topoisomerase IIb
  • U937 associated antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46466
Species: Hu
Applications: IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-89527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IF

Publications for TOP2B Antibody (NBP1-89527)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TOP2B Antibody (NBP1-89527) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: WB, IF.

Reviews using NBP1-89527:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot TOP2B NBP1-89527
Enlarge
reviewed by:
Anonymous
WB Human 08/04/2016
View

Summary

ApplicationWestern Blot
Sample TestedFibroblasts
SpeciesHuman
LotB105457

Blocking

Blocking Details5% Milk/TBS-T, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:250 in 5% Milk, TBS-T, 16H, 4C

Secondary Antibody

Secondary DescriptionAmersham ECL Rabbit IgG, HRP-linked whole Ab (from donkey)
Secondary Manufacturer Cat#NA934-100UL
Secondary Concentration1:5000

Details

Detection NotesECL, touch exposure

Comments

CommentsNon-specific bands detected at ~280 and 150kDA
Immunofluorescence TOP2B NBP1-89527
Enlarge
reviewed by:
Anonymous
IF Human 06/29/2016
View

Summary

ApplicationImmunofluorescence
Sample TestedFibroblasts
SpeciesHuman
LotB105457

Blocking

Blocking Details5% Normal Goat Serum/0.3% Triton X-100 in PBS, 1H RT

Primary Anitbody

Dilution Ratio2ug/mL, 16H, 4C, 1% BSA/ 0.3% Triton X-100 in PBS

Secondary Antibody

Secondary DescriptionAnti-rabbit IgG (H+L), F(ab')2 Fragment (Alexa Fluor® 555 Conjugate) #4413
Secondary Manufacturer Cat##4413
Secondary Concentration1:1000

Details

Detection Notesimaged with a Leica fluorescent scope. 50ms exposure, intensity 3
Fixation Details4% Paraformaldehyde (in PBS), 15 min fix RT
Wash DescriptionPBS 3X 5min with gentle agitation

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOP2B Antibody (NBP1-89527) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOP2B Products

Bioinformatics Tool for TOP2B Antibody (NBP1-89527)

Discover related pathways, diseases and genes to TOP2B Antibody (NBP1-89527). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOP2B Antibody (NBP1-89527)

Discover more about diseases related to TOP2B Antibody (NBP1-89527).
 

Pathways for TOP2B Antibody (NBP1-89527)

View related products by pathway.

PTMs for TOP2B Antibody (NBP1-89527)

Learn more about PTMs related to TOP2B Antibody (NBP1-89527).

Blogs on TOP2B

There are no specific blogs for TOP2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Anonymous
08/04/2016
Application: WB
Species: Human

Anonymous
06/29/2016
Application: IF
Species: Human

Bioinformatics

Gene Symbol TOP2B
Entrez