TOP2B Antibody

Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: TOP2B Antibody [NBP1-89527] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans and exocrine glandular cells.

Western Blot: TOP2B Antibody [NBP1-89527] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli and tubules.

Simple Western: TOP2B Antibody [NBP1-89527] - Simple Western lane view shows a specific band for TOP2B in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

Simple Western: TOP2B Antibody [NBP1-89527] - Electropherogram image(s) of corresponding Simple Western lane view. TOP2B antibody was used at 1:100 dilution on RT-4 lysate(s).

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TOP2B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOP2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:100
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  TOP2B Protein (NBP1-89527PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26439921).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOP2B Antibody

• antigen MLAA-44
• DNA topoisomerase 2-beta
• DNA topoisomerase II beta
• DNA topoisomerase II, 180 kD
• DNA topoisomerase II, beta isozyme
• EC 5.99.1.3
• TOP2B
• top2beta
• TOPIIB
• topo II beta
• topoisomerase (DNA) II beta (180kD)
• topoisomerase (DNA) II beta 180kDa
• topoisomerase II beta
• topoisomerase IIb
• U937 associated antigen

Background

Topo II Beta antibody plays important roles in synthesis and transcription of DNA as well as chromosomal segregation during mitosis. It is present ubiquitously in normal cells and is upregulated in tumors and proliferating cells. Further, it is implicated in drug resistance of tumor cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOP2B Antibody (NBP1-89527)(3)

Publications using NBP1-89527

• Hu HL, Shiflett LA, Kobayashi M et al. TOP2b-Dependent Nuclear DNA Damage Shapes Extracellular Growth Factor Responses via Dynamic AKT Phosphorylation to Control Virus Latency Mol. Cell 2019-03-26 [PMID: 30930055] (WB, Rat)
• Ali A, Biswas A, Pal M. HSF1 mediated TNF-a production during proteotoxic stress response pioneers proinflammatory signal in human cells. FASEB J. 2018-10-11 [PMID: 30307772] (WB, Human)
• Aviner R, Shenoy A, Elroy-Stein O, Geiger T. Uncovering Hidden Layers of Cell Cycle Regulation through Integrative Multi-omic Analysis. PLoS Genet 2015-10-01 [PMID: 26439921] (WB, Human)

Reviews for TOP2B Antibody (NBP1-89527) (2)

Average Rating: 4

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Jennifer Fox WB Human 08/04/2016

Summary

• Application: Western Blot
• Sample Tested: fibroblasts
• Species: Human
• Lot: B105457

reviewed by: Jennifer Fox IF Human 06/29/2016

Summary

• Application: Immunofluorescence
• Sample Tested: fibroblasts
• Species: Human
• Lot: B105457

Bioinformatics

• Gene Symbol: TOP2B