TNF RII/TNFRSF1B Antibody

Images

 
Western Blot: TNF RII/TNFRSF1B Antibody [NBP1-88139] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: TNF RII/TNFRSF1B Antibody [NBP1-88139] - Staining of human stomach shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNF RII/TNFRSF1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFRSF1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNF RII/TNFRSF1B Protein (NBP1-88139PEP)
Publications
Read Publications using NBP1-88139.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNF RII/TNFRSF1B Antibody

  • CD120b antigen
  • CD120b
  • Etanercept
  • p75 TNF receptor
  • p75TBPII
  • p75TNFR
  • soluble TNFR1B variant 1
  • TNF RII
  • TNFBRp80 TNF-alpha receptor
  • TNF-R2
  • TNFR2TNFR1B
  • TNF-R75
  • TNFR80
  • TNFRII
  • TNF-RII
  • TNF-R-II
  • TNFR-II
  • TNFRSF1B
  • tumor necrosis factor beta receptor
  • tumor necrosis factor binding protein 2
  • Tumor necrosis factor receptor 2
  • tumor necrosis factor receptor superfamily member 1B
  • tumor necrosis factor receptor superfamily, member 1B
  • Tumor necrosis factor receptor type II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-88139
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TNF RII/TNFRSF1B Antibody (NBP1-88139)(2)

Reviews for TNF RII/TNFRSF1B Antibody (NBP1-88139) (0)

There are no reviews for TNF RII/TNFRSF1B Antibody (NBP1-88139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNF RII/TNFRSF1B Antibody (NBP1-88139). (Showing 1 - 1 of 1 FAQs).

  1. Is this antibody purified to IgG only. This info is needed in order to make a control with a chromopure rabbit IgG.
    • NBP1-88139 is affinity purified, so this product should only contain the purified antibody (isotype rabbit IgG) in solution (PBS, glycerol, and sodium azide).

Secondary Antibodies

 

Isotype Controls

Additional TNF RII/TNFRSF1B Products

Bioinformatics Tool for TNF RII/TNFRSF1B Antibody (NBP1-88139)

Discover related pathways, diseases and genes to TNF RII/TNFRSF1B Antibody (NBP1-88139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNF RII/TNFRSF1B Antibody (NBP1-88139)

Discover more about diseases related to TNF RII/TNFRSF1B Antibody (NBP1-88139).
 

Pathways for TNF RII/TNFRSF1B Antibody (NBP1-88139)

View related products by pathway.

PTMs for TNF RII/TNFRSF1B Antibody (NBP1-88139)

Learn more about PTMs related to TNF RII/TNFRSF1B Antibody (NBP1-88139).
 

Research Areas for TNF RII/TNFRSF1B Antibody (NBP1-88139)

Find related products by research area.

Blogs on TNF RII/TNFRSF1B

There are no specific blogs for TNF RII/TNFRSF1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNF RII/TNFRSF1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF1B
Entrez