| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 383-492 of Human TMPRSS2 Source: Wheat Germ (in vitro) Amino Acid Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | TMPRSS2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00007113-Q01 | Applications | Species |
|---|---|---|
| Anjali S, Marcos C, Sai B et al. Single-Virus Fusion Measurements Reveal Multiple Mechanistically Equivalent Pathways for SARS-CoV-2 Entry. J Virol. 2023-05-03 [PMID: 37133381] |
Research Areas for TMPRSS2 Partial Recombinant Protein (H00007113-Q01)Find related products by research area.
|
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
|
COVID-19 and the Cardiovascular System: Observed complications and potential mechanisms By Victoria OsinskiThe outbreak of COVID-19 resulting from the transmission of the novel severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) has resulted in many cases of illness typically manifesting in mi... Read full blog post. |
|
Blocking SARS-CoV-2 Cell Entry: A potential Strategy Against COVID-19 Pandemic By Jamshed Arslan, Pharm. D., PhD. Coronaviruses are a family of enveloped RNA viruses. Some family members circulate in human populations, but others like severe acute respiratory syndrome coronavirus (SARS-CoV) ar... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMPRSS2 |