Recombinant Human TMPRSS2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human TMPRSS2 Protein [H00007113-Q01] - 12.5% SDS-PAGE using partial Recombinant Human TMPRSS2 Protein stained with Coomassie Blue. Molecular weight of ~ 37.84 KDa.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human TMPRSS2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 383-492 of Human TMPRSS2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TMPRSS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00007113-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMPRSS2 GST (N-Term) Protein

  • EC 3.4.21
  • Epitheliasin
  • FLJ41954
  • NP_001128571.1
  • NP_001369649.1
  • NP_005647.3
  • PP9284
  • PRSS10
  • Serine protease 10
  • TMPRSS2
  • transmembrane protease serine 2
  • transmembrane protease, serine 2

Background

TMPRSS2, also called Epitheliasin in mice, is a 492 amino acid type II transmembrane serine protease located on human chromosome 21q22.3 that encodes at least 2 isoforms. This glycosylated serine protease (theoretical molecular weight 70kDa) is regulated by androgens and expressed on the plasma membrane of human bronchial epithelial cells, nasal goblet cells, small intestine epithelia, gastrointestinal tract, the stomach, kidneys and pancreas, with the greatest abundance found in the prostate gland. While the physiological function of TMPRSS2 remains unknown, the serine protease domain undergoes autocleavage and the 32 kDa domain is secreted enabling its interaction with the extracellular matrix. Fusions between TMPRSS2 and the ETS transcription factor genes ERG, ETV1, and ETV4 have been reported in prostate cancer with the TMPRSS2 ERG gene fusion resulting in ERG overexpression in 40-80% of these cases and often producing a more aggressive phenotype. Androgen signaling is disrupted in prostate cancers with the TMPRSS2 ERG fusion which contributes to the switch from androgen dependent to androgen independent prostate cancer (1,2).

TMPRSS2 has also been shown to play a critical role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 at the cell surface to facilitate viral entry. TMPRSS2 mediates viral entry in a similar mechanism for other coronaviruses such as SARS-CoV and MERS. The broad-spectrum serine protease inhibitor, Camostat, is a TMPRSS2 inhibitor demonstrated to protect mice with lethal SARS-CoV infections (3).

References

1. Clark, J., Cooper, C. (2009) ETS gene fusions in prostate cancer. Nat Rev Urol 6, 429-439. PMID: 19657377

2. Duffy, MJ. (2014) Chapter One - PSA in Screening for Prostate Cancer: More Good than Harm or More Harm than Good? Adv Clin Chem. 66:1-23. PMID: 25344984

3. Shen LW, Mao HJ, Wu YL, Tanaka Y, Zhang W. (2017) TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections. Biochimie. 142:1-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67375
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
H00002115-M01
Species: Hu
Applications: ELISA, WB
NBP3-35390
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
4776-SE
Species: Hu
Applications: EnzAct
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87168
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00007113-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for TMPRSS2 Partial Recombinant Protein (H00007113-Q01)(1)

Reviews for TMPRSS2 Partial Recombinant Protein (H00007113-Q01) (0)

There are no reviews for TMPRSS2 Partial Recombinant Protein (H00007113-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS2 Partial Recombinant Protein (H00007113-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMPRSS2 Products

Research Areas for TMPRSS2 Partial Recombinant Protein (H00007113-Q01)

Find related products by research area.

Blogs on TMPRSS2.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

COVID-19 and the Cardiovascular System: Observed complications and potential mechanisms
By Victoria OsinskiThe outbreak of COVID-19 resulting from the transmission of the novel severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) has resulted in many cases of illness typically manifesting in mi...  Read full blog post.

Blocking SARS-CoV-2 Cell Entry: A potential Strategy Against COVID-19 Pandemic
By Jamshed Arslan, Pharm. D., PhD. Coronaviruses are a family of enveloped RNA viruses. Some family members circulate in human populations, but others like severe acute respiratory syndrome coronavirus (SARS-CoV) ar...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMPRSS2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS2