TMPRSS2 Antibody

Images

 
Western Blot: TMPRSS2 Antibody [H00007113-B01P] - Analysis of TMPRSS2 expression in transfected 293T cell line by TMPRSS2 polyclonal antibody. Lane 1: TMPRSS2 transfected lysate(53.90 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TMPRSS2 Antibody Summary

Immunogen
TMPRSS2 (AAH51839.1, 1 a.a. - 492 a.a.) full-length human protein. MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TMPRSS2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMPRSS2 Antibody

  • EC 3.4.21
  • EC 3.4.21.109
  • FLJ41954
  • PP9284
  • PRSS10epitheliasin
  • Serine protease 10
  • transmembrane protease serine 2
  • transmembrane protease, serine 2
  • transmembrane protease, serine 2, EC 3.4.2110EC 3.4.21.-

Background

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to be involved in many physiological and pathological processes. This gene was demonstrated to be up-regulated by androgenic hormones in prostate cancer cells and down-regulated in androgen-independent prostate cancer tissue. The protease domain of this protein is thought to be cleaved and secreted into cell media after autocleavage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87960
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003249-P01
Species: Hu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF933
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00007113-B01P
Species: Hu
Applications: WB

Publications for TMPRSS2 Antibody (H00007113-B01P) (0)

There are no publications for TMPRSS2 Antibody (H00007113-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMPRSS2 Antibody (H00007113-B01P) (0)

There are no reviews for TMPRSS2 Antibody (H00007113-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMPRSS2 Antibody (H00007113-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMPRSS2 Products

Bioinformatics Tool for TMPRSS2 Antibody (H00007113-B01P)

Discover related pathways, diseases and genes to TMPRSS2 Antibody (H00007113-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMPRSS2 Antibody (H00007113-B01P)

Discover more about diseases related to TMPRSS2 Antibody (H00007113-B01P).
 

Pathways for TMPRSS2 Antibody (H00007113-B01P)

View related products by pathway.

PTMs for TMPRSS2 Antibody (H00007113-B01P)

Learn more about PTMs related to TMPRSS2 Antibody (H00007113-B01P).
 

Research Areas for TMPRSS2 Antibody (H00007113-B01P)

Find related products by research area.

Blogs on TMPRSS2

There are no specific blogs for TMPRSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMPRSS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMPRSS2
Uniprot