TMEM9 Antibody

Images

 
Western Blot: TMEM9 Antibody [NBP1-69589] - This Anti-TMEM9 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM9 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM9(transmembrane protein 9) The peptide sequence was selected from the C terminal of TMEM9. Peptide sequence DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM9 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM9 Antibody

  • Dermal papilla-derived protein 4
  • DERP4
  • TMEM9A
  • transmembrane protein 9

Background

TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88545
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03265
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-62435
Species: Hu
Applications: WB, IHC, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56363
Species: Hu, Mu
Applications: WB
NBP1-69589
Species: Hu
Applications: WB

Publications for TMEM9 Antibody (NBP1-69589) (0)

There are no publications for TMEM9 Antibody (NBP1-69589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM9 Antibody (NBP1-69589) (0)

There are no reviews for TMEM9 Antibody (NBP1-69589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM9 Antibody (NBP1-69589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM9 Products

Bioinformatics Tool for TMEM9 Antibody (NBP1-69589)

Discover related pathways, diseases and genes to TMEM9 Antibody (NBP1-69589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM9 Antibody (NBP1-69589)

Discover more about diseases related to TMEM9 Antibody (NBP1-69589).
 

Pathways for TMEM9 Antibody (NBP1-69589)

View related products by pathway.

PTMs for TMEM9 Antibody (NBP1-69589)

Learn more about PTMs related to TMEM9 Antibody (NBP1-69589).

Blogs on TMEM9

There are no specific blogs for TMEM9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM9
Uniprot