GPAA1 Antibody - BSA Free

Western Blot: GPAA1 Antibody [NBP1-62435] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry: GPAA1 Antibody [NBP1-62435] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time

Immunohistochemistry-Paraffin: GPAA1 Antibody [NBP1-62435] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Immunohistochemistry: GPAA1 Antibody [NBP1-62435] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPAA1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GPAA1(glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)) The peptide sequence was selected from the C terminal of GPAA1. Peptide sequence LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPAA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPAA1 Antibody - BSA Free

• anchor attachment protein 1 (Gaa1p, yeast) homolog
• GAA1 protein homolog
• GAA1glycophosphatidylinositol anchor attachment 1
• glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
• GPAA1P anchor attachment protein 1 homolog (yeast)
• GPAA1P anchor attachment protein 1 homolog
• GPI anchor attachment protein 1
• GPI transamidase subunit
• hGAA1glycosylphosphatidylinositol anchor attachment 1 protein

Background

Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. GPAA1 presumably functions in GPI anchoring at the GPI transfer step. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.Posttranslational glycosylphosphatidylinositol (GPI) anchor attachment serves as a general mechanism for linking proteins to the cell surface membrane. The protein encoded by this gene presumably functions in GPI anchoring at the GPI transfer step. The mRNA transcript is ubiquitously expressed in both fetal and adult tissues. The anchor attachment protein 1 contains an N-terminal signal sequence, 1 cAMP- and cGMP-dependent protein kinase phosphorylation site, 1 leucine zipper pattern, 2 potential N-glycosylation sites, and 8 putative transmembrane domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPAA1
• Uniprot:
  • O43292(Human)