TMEM8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TMEM8 Antibody [NBP2-55929] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM8A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM8 Recombinant Protein Antigen (NBP2-55929PEP)

Reactivity Notes

Mouse 81%, Rat 82%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM8 Antibody - BSA Free

• five-span transmembrane protein M83
• Protein M83
• TMEM6
• TMEM8
• Transmembrane protein 6M83
• transmembrane protein 8 (five membrane-spanning domains)
• Transmembrane protein 8
• transmembrane protein 8A

Background

TMEM8 may be a cell surface adhesion molecule. May be involved in the maintenance of the resting T-cell state

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM8A