TMEM8 Antibody

Immunocytochemistry/Immunofluorescence: TMEM8 Antibody [NBP2-30919] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytokinetic bridge.

Immunohistochemistry: TMEM8 Antibody [NBP2-30919] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TMEM8 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM8A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM8 Protein (NBP2-30919PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM8 Antibody

• five-span transmembrane protein M83
• Protein M83
• TMEM6
• TMEM8
• Transmembrane protein 6M83
• transmembrane protein 8 (five membrane-spanning domains)
• Transmembrane protein 8
• transmembrane protein 8A

Background

TMEM8 may be a cell surface adhesion molecule. May be involved in the maintenance of the resting T-cell state

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM8A
• Uniprot:
  • Q9HCN3(Human)