TMEM200C Antibody

Images

 
Immunohistochemistry: Transmembrane Protein 200C Antibody [NBP2-30818] - Staining of human kidney shows strong cytoplasmic and membranous positivity in subset of cells in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM200C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GYWPKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSA
Specificity
Specificity of human TMEM200C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM200C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM200C Protein (NBP2-30818PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM200C Antibody

  • TMEM200C
  • Transmembrane Protein TTMA
  • TTMA
  • Two Transmembrane Domain Family Member A
  • Two Transmembrane Domain-Containing Family Member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-76911
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-05054
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-57496
Species: Hu
Applications: ICC/IF
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30818
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM200C Antibody (NBP2-30818) (0)

There are no publications for TMEM200C Antibody (NBP2-30818).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM200C Antibody (NBP2-30818) (0)

There are no reviews for TMEM200C Antibody (NBP2-30818). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM200C Antibody (NBP2-30818) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM200C Products

Bioinformatics Tool for TMEM200C Antibody (NBP2-30818)

Discover related pathways, diseases and genes to TMEM200C Antibody (NBP2-30818). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM200C

There are no specific blogs for TMEM200C, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM200C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM200C
Uniprot