TMEM1 Antibody (5B4)

Images

 
Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - TMEM1 monoclonal antibody (M01), clone 5B4 Analysis of TMEM1 expression in Hela S3 NE.
Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - Analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi ( Cat # H00007109-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - Analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody (M01), clone 5B4.Lane 1: TMEM1 transfected lysate(142.2 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
5B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TMEM1 Antibody (5B4) Summary

Immunogen
TMEM1 (NP_003265 1162 a.a. - 1257 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
Specificity
TMEM1 (5B4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRAPPC10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.
Publications
Read Publication using H00007109-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEM1 Antibody (5B4)

  • EHOC-1FLJ55683
  • EHOC1GT334
  • Epilepsy holoprosencephaly candidate 1 protein
  • epilepsy holoprosencephaly candidate-1 protein
  • FLJ54223
  • FLJ54817
  • Protein GT334
  • TMEM1MGC126777
  • trafficking protein particle complex 10
  • trafficking protein particle complex subunit 10
  • trafficking protein particle complex subunit 130
  • Trafficking protein particle complex subunit TMEM1
  • transmembrane protein 1
  • Transport protein particle subunit TMEM1
  • TRAPP 130 kDa subunit
  • TRAPP subunit TMEM1
  • TRS130
  • TRS30

Background

The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003954-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-86663
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-35213
Species: Hu
NBP1-85934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00007109-M01
Species: Hu
Applications: WB, ELISA, RNAi

Publications for TMEM1 Antibody (H00007109-M01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TMEM1 Antibody (H00007109-M01) (0)

There are no reviews for TMEM1 Antibody (H00007109-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM1 Antibody (H00007109-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM1 Products

Bioinformatics Tool for TMEM1 Antibody (H00007109-M01)

Discover related pathways, diseases and genes to TMEM1 Antibody (H00007109-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM1 Antibody (H00007109-M01)

Discover more about diseases related to TMEM1 Antibody (H00007109-M01).
 

Pathways for TMEM1 Antibody (H00007109-M01)

View related products by pathway.

Blogs on TMEM1

There are no specific blogs for TMEM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM1 Antibody (5B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC10
Entrez
OMIM
Uniprot