TMEM1 Antibody (5B4)

Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - TMEM1 monoclonal antibody (M01), clone 5B4 Analysis of TMEM1 expression in Hela S3 NE.

Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - Analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi ( Cat # H00007109-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody (M01), clone 5B4 (Cat # H00007109-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: TMEM1 Antibody (5B4) [H00007109-M01] - Analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody (M01), clone 5B4.Lane 1: TMEM1 transfected lysate(142.2 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, KD
• Clone: 5B4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

TMEM1 Antibody (5B4) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
• Specificity: TMEM1 (5B4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TRAPPC10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEM1 Antibody (5B4)

• EHOC-1FLJ55683
• EHOC1GT334
• Epilepsy holoprosencephaly candidate 1 protein
• epilepsy holoprosencephaly candidate-1 protein
• FLJ54223
• FLJ54817
• Protein GT334
• TMEM1MGC126777
• trafficking protein particle complex 10
• trafficking protein particle complex subunit 10
• trafficking protein particle complex subunit 130
• Trafficking protein particle complex subunit TMEM1
• transmembrane protein 1
• Transport protein particle subunit TMEM1
• TRAPP 130 kDa subunit
• TRAPP subunit TMEM1
• TRS130
• TRS30

Background

The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM1 Antibody (H00007109-M01)(1)

Publication using H00007109-M01

• Zong M, Satoh A, Yu MK et al. TRAPPC9 mediates the interaction between p150 and COPII vesicles at the target membrane. PLoS One. 2012-01-01 [PMID: 22279557] (Human)

Bioinformatics

• Gene Symbol: TRAPPC10
• Entrez:
  • 7109(Human)
• OMIM:
  • 602103(Human)
• Uniprot:
  • NP_003265(Human)