Tm9sf3 Antibody - BSA Free

Western Blot: Tm9sf3 Antibody [NBP2-83659] - Host: Rabbit. Target Name: Tm9sf3. Sample Type: Rat Pancreas lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Tm9sf3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of rat Tm9sf3. Peptide sequence: NRQETYKYFSLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM9SF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Tm9sf3 Antibody - BSA Free

• transmembrane 9 superfamily member 3

Background

Tm9sf3 is a gene that codes for a multi-pass membrane protein that is 589 amino acids long and weighs approximately 68 kDa. Current studies are being done on diseases and disorders related to this gene including Alzheimer's disease and malaria. Tm9sf3 has also been shown to have interactions with UNC93B1, SYS1, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM9SF3