TM4SF4 Antibody

Images

 
Western Blot: TM4SF4 Antibody [NBP1-69647] - This Anti-TM4SF4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM4SF4 Antibody Summary

Immunogen
Synthetic peptides corresponding to TM4SF4(transmembrane 4 L six family member 4) The peptide sequence was selected from the N terminal of TM4SF4. Peptide sequence CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM4SF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TM4SF4 and was validated on Western blot.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TM4SF4 Antibody

  • FLJ31015
  • ILTMP
  • il-TMP
  • ILTMPintestinal and liver (il) tetraspan membrane protein
  • Intestine and liver tetraspan membrane protein
  • TM4SF4
  • transmembrane 4 L six family member 4
  • transmembrane 4 L6 family member 4
  • transmembrane 4 superfamily member 4

Background

TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. The use of alternate polyadenylation sites has been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
H00007348-M05
Species: Hu
Applications: WB, ELISA
H00056547-M01
Species: Hu
Applications: WB, ELISA
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF3444
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-69647
Species: Hu
Applications: WB

Publications for TM4SF4 Antibody (NBP1-69647) (0)

There are no publications for TM4SF4 Antibody (NBP1-69647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM4SF4 Antibody (NBP1-69647) (0)

There are no reviews for TM4SF4 Antibody (NBP1-69647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM4SF4 Antibody (NBP1-69647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM4SF4 Products

Bioinformatics Tool for TM4SF4 Antibody (NBP1-69647)

Discover related pathways, diseases and genes to TM4SF4 Antibody (NBP1-69647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM4SF4 Antibody (NBP1-69647)

Discover more about diseases related to TM4SF4 Antibody (NBP1-69647).
 

Pathways for TM4SF4 Antibody (NBP1-69647)

View related products by pathway.

Research Areas for TM4SF4 Antibody (NBP1-69647)

Find related products by research area.

Blogs on TM4SF4

There are no specific blogs for TM4SF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM4SF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM4SF4
Entrez
Uniprot