Recombinant Human TM2D1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TM2D1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33-207 of Human BBP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TM2D1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TM2D1 Protein

  • BBPBeta-amyloid-binding protein
  • hBBP
  • TM2 domain containing 1
  • TM2 domain-containing protein 1

Background

BBP( AAH29486, 33 a.a. - 208 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt

Publications for TM2D1 Recombinant Protein (H00083941-P01) (0)

There are no publications for TM2D1 Recombinant Protein (H00083941-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM2D1 Recombinant Protein (H00083941-P01) (0)

There are no reviews for TM2D1 Recombinant Protein (H00083941-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TM2D1 Recombinant Protein (H00083941-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TM2D1 Products

Bioinformatics Tool for TM2D1 Recombinant Protein (H00083941-P01)

Discover related pathways, diseases and genes to TM2D1 Recombinant Protein (H00083941-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TM2D1

There are no specific blogs for TM2D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF
TM2D1 Antibody
NBP2-13436

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TM2D1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TM2D1