TLK1 Antibody - BSA Free

Western Blot: TLK1 Antibody [NBP3-35473] - Western blot analysis of various lysates using TLK1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

Immunohistochemistry: TLK1 Antibody [NBP3-35473] - Immunohistochemistry analysis of paraffin-embedded Human placenta using TLK1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: TLK1 Antibody [NBP3-35473] - Immunohistochemistry analysis of paraffin-embedded Rat heart using TLK1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: TLK1 Antibody [NBP3-35473] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using TLK1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TLK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TLK1 Antibody - BSA Free (NBP3-35473) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3).
  
  Sequence:
  PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TLK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:100
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 87 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TLK1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• KIAA0137serine/threonine-protein kinase tousled-like 1
• PKU-beta
• SNARE protein kinase SNAK
• tousled-like kinase 1serine threonine protein kinase

Background

Tousled-like kinase 1 (TLK1) is a serine/threonine kinase involved in chromatin assembly and the DNA damage response. The tousled (Tsl) kinase was first identified in Arabidopsis thaliana and speculated to be involved in cell division during patterning of plant organs. There are two tousled-like kinases in humans, TLK1 and TLK2, that can dimerize or heterodimerize for function and can be phosphorylated and inactivated by Chk1 in response to DNA damage. The histone chaperone, Asf1 (anti-silencing function 1), has been reported as a substrate for both TLK1 and TLK2. TLK1 has also been shown to be important for cell cycle progression and proper chromosome segregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TLK1