TL1A/TNFSF15 Recombinant Protein Antigen

Images

 
There are currently no images for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TL1A/TNFSF15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TL1A/TNFSF15.

Source: E. coli

Amino Acid Sequence: QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TNFSF15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58139.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TL1A/TNFSF15 Recombinant Protein Antigen

  • MGC129934
  • MGC129935
  • TL1A
  • TL1Vascular endothelial cell growth inhibitor
  • TNF superfamily ligand TL1A
  • TNFSF15
  • tumor necrosis factor (ligand) superfamily, member 15
  • tumor necrosis factor ligand superfamily member 15
  • vascular endothelial growth inhibitor-192A
  • VEGI
  • VEGI192A
  • VEGITNF ligand-related molecule 1

Background

VEGI is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

943-D3
Species: Hu
Applications: Bind
DY142
Species: Hu
Applications: ELISA
485-MI
Species: Mu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
664-LI
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7625
Species: Mu
Applications: ELISA
375-TL
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
DY421
Species: Mu
Applications: ELISA
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DY413
Species: Mu
Applications: ELISA
AF2658
Species: Hu
Applications: ICC, IHC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP2-58139PEP
Species: Hu
Applications: AC

Publications for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP) (0)

There are no publications for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP) (0)

There are no reviews for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TL1A/TNFSF15 Products

Research Areas for TL1A/TNFSF15 Recombinant Protein Antigen (NBP2-58139PEP)

Find related products by research area.

Blogs on TL1A/TNFSF15

There are no specific blogs for TL1A/TNFSF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TL1A/TNFSF15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF15