TIP30 Antibody

Images

 
Western Blot: TIP30 Antibody [NBP1-88171] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TIP30 Antibody [NBP1-88171] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIP30 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTATIP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TIP30 Protein (NBP1-88171PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIP30 Antibody

  • 30 kDa HIV-1 TAT-interacting protein
  • CC3oxidoreductase HTATIP2
  • EC 1.1.1
  • EC 1.1.1.-
  • FLJ26963
  • HIV-1 Tat interactive protein 2, 30 kDa
  • HIV-1 Tat interactive protein 2, 30kDa
  • HIV-1 TAT-interactive protein 2
  • SDR44U1
  • Tat-interacting protein (30kD)
  • TIP30short chain dehydrogenase/reductase family 44U, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB6860
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
AF2364
Species: Hu
Applications: WB, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for TIP30 Antibody (NBP1-88171) (0)

There are no publications for TIP30 Antibody (NBP1-88171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIP30 Antibody (NBP1-88171) (0)

There are no reviews for TIP30 Antibody (NBP1-88171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIP30 Antibody (NBP1-88171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIP30 Products

Bioinformatics Tool for TIP30 Antibody (NBP1-88171)

Discover related pathways, diseases and genes to TIP30 Antibody (NBP1-88171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIP30 Antibody (NBP1-88171)

Discover more about diseases related to TIP30 Antibody (NBP1-88171).
 

Pathways for TIP30 Antibody (NBP1-88171)

View related products by pathway.

PTMs for TIP30 Antibody (NBP1-88171)

Learn more about PTMs related to TIP30 Antibody (NBP1-88171).
 

Research Areas for TIP30 Antibody (NBP1-88171)

Find related products by research area.

Blogs on TIP30

There are no specific blogs for TIP30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIP30 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTATIP2