TIP120B Antibody - Azide and BSA Free

Western Blot: TIP120B Antibody [NBP2-94561] - Analysis of extracts of various cell lines, using TIP120B at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 15s.

Immunohistochemistry-Paraffin: TIP120B Antibody [NBP2-94561] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using TIP120B Rabbit pAb (NBP2-94561) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TIP120B Antibody [NBP2-94561] - Immunohistochemistry of paraffin-embedded Mouse spleen using TIP120B Rabbit pAb (NBP2-94561) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TIP120B Antibody [NBP2-94561] - Immunohistochemistry of paraffin-embedded Rat testis using TIP120B Rabbit pAb (NBP2-94561) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TIP120B Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 850-1000 of human CAND2 (NP_001155971.1). VGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAAGRPHTRSTVITAVKFLISD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAND2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for TIP120B Antibody - Azide and BSA Free

• cullin-associated and neddylation-dissociated 2 (putative)
• Cullin-associated and neddylation-dissociated protein 2
• cullin-associated NEDD8-dissociated protein 2
• epididymis tissue protein Li 169
• KIAA0667TBP-interacting protein of 120 kDa B
• p120 CAND2
• TBP interacting protein
• TBP-interacting protein 120B
• TIP120BTp120b

Background

CAND2 is also known as TIP120B, and TATA-binding protein-interacting protein 120B. While both CAND1 (TIP120A) and CAND2 (TIP120B) are TATA-binding proteins and form complexes with various nuclear proteins involved in the control of eukaryotic gene transcription, CAND2 (TIP120B) is expressed specifically in muscle and heart tissue. This is contrary to the ubiquitous expression of CAND1 (TIP120A). TIP120 homologs exist in various higher eukaryotes including D. melanogaster, C. elegans, and A. thaliana. TIP120B is 60% identical in amino acid sequence to TIP120A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: CAND2