TIP120A Antibody (5D7)

Images

 
Western Blot: TIP120A Antibody (5D7) [H00055832-M01] - CAND1 monoclonal antibody (M01), clone 5D7 Analysis of CAND1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: TIP120A Antibody (5D7) [H00055832-M01] - Analysis of monoclonal antibody to CAND1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TIP120A Antibody (5D7) [H00055832-M01] - Analysis of monoclonal antibody to CAND1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: TIP120A Antibody (5D7) [H00055832-M01] - Detection limit for recombinant GST tagged CAND1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
5D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIP120A Antibody (5D7) Summary

Immunogen
CAND1 (NP_060918, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Specificity
CAND1 - cullin-associated and neddylation-dissociated 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CAND1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00055832-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIP120A Antibody (5D7)

  • cullin-associated and neddylation-dissociated 1
  • Cullin-associated and neddylation-dissociated protein 1
  • cullin-associated NEDD8-dissociated protein 1
  • DKFZp434M1414
  • FLJ90441
  • KIAA0829FLJ10114
  • p120 CAND1
  • TBP interacting protein
  • TBP-interacting protein 120A
  • TBP-interacting protein of 120 kDa A
  • TIP120AFLJ38691
  • TIP120FLJ10929

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-75643
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-78048
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-76825
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-75459
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00055832-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for TIP120A Antibody (H00055832-M01)(4)

Reviews for TIP120A Antibody (H00055832-M01) (0)

There are no reviews for TIP120A Antibody (H00055832-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIP120A Antibody (H00055832-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIP120A Products

Bioinformatics Tool for TIP120A Antibody (H00055832-M01)

Discover related pathways, diseases and genes to TIP120A Antibody (H00055832-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIP120A Antibody (H00055832-M01)

Discover more about diseases related to TIP120A Antibody (H00055832-M01).
 

Pathways for TIP120A Antibody (H00055832-M01)

View related products by pathway.

PTMs for TIP120A Antibody (H00055832-M01)

Learn more about PTMs related to TIP120A Antibody (H00055832-M01).

Blogs on TIP120A

There are no specific blogs for TIP120A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIP120A Antibody (5D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CAND1
Entrez
OMIM
Uniprot