CNOT3 Antibody (4B8)

Images

 
Western Blot: CNOT3 Antibody (4B8) [H00004849-M01] - CNOT3 monoclonal antibody (M01), clone 4B8 Analysis of CNOT3 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: CNOT3 Antibody (4B8) [H00004849-M01] - Analysis of monoclonal antibody to CNOT3 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: CNOT3 Antibody (4B8) [H00004849-M01] - Analysis of CNOT3 expression in transfected 293T cell line by CNOT3 monoclonal antibody (M01), clone 4B8.Lane 1: CNOT3 transfected lysate(82 KDa).Lane 2: ...read more
ELISA: CNOT3 Antibody (4B8) [H00004849-M01] - Detection limit for recombinant GST tagged CNOT3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, KO
Clone
4B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CNOT3 Antibody (4B8) Summary

Immunogen
CNOT3 (NP_055331, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
Localization
Cytoplasmic and Nuclear
Specificity
CNOT3 - CCR4-NOT transcription complex, subunit 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CNOT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Knockout Validated
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for IF and ELISA. Knock Out Validation was reported in scientific literature (PMID: 27746116).
Publications
Read Publications using H00004849-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNOT3 Antibody (4B8)

  • CCR4-NOT transcription complex, subunit 3
  • KIAA0691CCR4-associated factor 3
  • LENG2yeast) homolog
  • Leukocyte receptor cluster member 2

Background

CNOT3 is a protein component of CCR4 NOT protein complex, a general transcription regulation complex. It has 3 named isoforms produced by alternative splicing. Yeast CCR4 NOT is a global regulator of RNA polymerase II transcription. It is comprised of yeast NOT1 to NOT5, yeast CCR4 and additional proteins like yeast CAF1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15930
Species: Hu
Applications: WB, ICC/IF
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46323
Species: Hu
Applications: WB, IHC
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-24527
Species: Hu, Mu, Rt, Bv, Ch, Xp
Applications: WB, IHC-P
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
H00055832-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-78048
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC

Publications for CNOT3 Antibody (H00004849-M01)(7)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CNOT3 Antibody (H00004849-M01) (0)

There are no reviews for CNOT3 Antibody (H00004849-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNOT3 Antibody (H00004849-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT3 Products

Bioinformatics Tool for CNOT3 Antibody (H00004849-M01)

Discover related pathways, diseases and genes to CNOT3 Antibody (H00004849-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT3 Antibody (H00004849-M01)

Discover more about diseases related to CNOT3 Antibody (H00004849-M01).
 

Pathways for CNOT3 Antibody (H00004849-M01)

View related products by pathway.

Blogs on CNOT3

There are no specific blogs for CNOT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT3 Antibody (4B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT3
Entrez
OMIM
Uniprot