TIMP-2 Antibody (5P3T3)

Western Blot: TIMP-2 Antibody (8R5Q2) [NBP3-16074] - Western blot analysis of extracts of various cell lines, using TIMP-2 antibody (NBP3-16074) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 20s.

Western Blot: TIMP-2 Antibody (8R5Q2) [NBP3-16074] - Western blot analysis of extracts of various cell lines, using TIMP-2 antibody (NBP3-16074) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

• Reactivity: Hu, Mu, Rt, Pm
• Applications: WB
• Clone: 5P3T3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TIMP-2 Antibody (5P3T3) Summary

• Description: Novus Biologicals Rabbit TIMP-2 Antibody (5P3T3) (NBP3-16074) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant protein of human TIMP-2. VSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TIMP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Reactivity Notes

African green monkey

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TIMP-2 Antibody (5P3T3)

• CSC-21Ktissue inhibitor of metalloproteinase 2
• metalloproteinase inhibitor 2
• TIMP metallopeptidase inhibitor 2
• TIMP2
• TIMP-2
• Tissue inhibitor of metalloproteinases 2

Background

The TIMP2 gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMP2