TIMM50 Antibody

Images

 
Western Blot: TIMM50 Antibody [NBP2-38791] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: TIMM50 Antibody [NBP2-38791] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry: TIMM50 Antibody [NBP2-38791] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIMM50 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TIMM50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIMM50 Protein (NBP2-38791PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TIMM50 Antibody

  • homolog of yeast Tim50
  • MGC102733
  • mitochondrial import inner membrane translocase subunit TIM50
  • TIM50
  • TIM50L
  • Tim50-like protein
  • translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
  • translocase of inner mitochondrial membrane 50 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80671
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92509
Species: Hu
Applications: WB, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
H00005956-R02
Species: Hu
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TIMM50 Antibody (NBP2-38791) (0)

There are no publications for TIMM50 Antibody (NBP2-38791).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM50 Antibody (NBP2-38791) (0)

There are no reviews for TIMM50 Antibody (NBP2-38791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMM50 Antibody (NBP2-38791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMM50 Products

Bioinformatics Tool for TIMM50 Antibody (NBP2-38791)

Discover related pathways, diseases and genes to TIMM50 Antibody (NBP2-38791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM50 Antibody (NBP2-38791)

Discover more about diseases related to TIMM50 Antibody (NBP2-38791).
 

Pathways for TIMM50 Antibody (NBP2-38791)

View related products by pathway.

PTMs for TIMM50 Antibody (NBP2-38791)

Learn more about PTMs related to TIMM50 Antibody (NBP2-38791).

Blogs on TIMM50

There are no specific blogs for TIMM50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMM50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM50
Uniprot