Home » TICRR » TICRR Antibodies » TICRR Antibody

TICRR Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: TICRR Antibody [NBP2-58491] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunocytochemistry/ Immunofluorescence: TICRR Antibody [NBP2-58491] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TICRR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE
Specificity
Specificity of human TICRR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TICRR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TICRR Recombinant Protein Antigen (NBP2-58491PEP)

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TICRR Antibody

  • C15orf42
  • Chromosome 15 Open Reading Frame 42
  • SLD3 Homolog (S. Cerevisiae)
  • SLD3 Homolog
  • SLD3
  • TOPBP1-Interacting Checkpoint And Replication Regulator
  • TOPBP1-Interacting Replication-Stimulating Protein
  • TopBP1-Interacting, Replication-Stimulating Protein
  • Treslin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC45L Antibody
(JJ091-04)
NBP2-67897
Immunocytochemistry/Immunofluorescence: CDC45L Antibody (JJ091-04) [NBP2-67897] - Staining CDC45 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: CDC45L Antibody (JJ091-04) [NBP2-67897] - Analysis of paraffin-embedded mouse colon tissue using anti-CDC45 antibody. Counter stained with hematoxylin.
Flow Cytometry: CDC45L Antibody (JJ091-04) [NBP2-67897] - Analysis of 293 cells with CDC45 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
TopBP1 Antibody
NB100-217
Western Blot: TopBP1 Antibody [NB100-217] - Detection of mouse TopBP1 by western blot. Samples: Whole cell lysate (50 ug) from TCMK-1 and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-TopBP1 antibody NB100-217 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Western Blot: TopBP1 Antibody [NB100-217] - Sample: Whole cell lysate (50 ug for WB) from HeLa cells.
Western Blot: TopBP1 Antibody [NB100-217] - WB analysis of TOPBP1 in HeLa cell extract mitotic and interphase. Image courtesy of product review submitted by Jennifer Flynn.
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: WB, IP
Chk2 Antibody
(73C175.1.1)
NB100-56546
Western Blot: Chk2 Antibody (73C175.1.1) [NB100-56546] - Western Blot: Chk2 Antibody (73C175.1.1) - Azide Free [NBP2-27403] - analysis of Chk2 in 293 cell lysate. A protein band of approximate molecular weight of 60-62 kDa is detected with Chk2 antibody at 2 ug/ml. Image using the Azide Free form of this antibody.
Immunocytochemistry/Immunofluorescence: Chk2 Antibody (73C175.1.1) [NB100-56546] - Hek293 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-Chk2 (73C175.1.1) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Chk2 Antibody (73C175.1.1) [NB100-56546] - Staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PIK3CA Antibody
NBP2-19804
Western Blot: PIK3CA Antibody [NBP2-19804] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with PI3 kinase p110 alpha antibody diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: PIK3CA Antibody [NBP2-19804] - HCT 116 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: PI3 kinase p110 alpha protein stained by PI3 kinase p110 alpha antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PIK3CA Antibody [NBP2-19804] - PIK3CA Antibody Immunohistochemical analysis of paraffin-embedded Human Breast Cancer, using PI3 kinase p110 alpha antibody.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CASK Antibody
NBP2-76922
Western Blot: CASK Antibody [NBP2-76922] - Western blot analysis of CASK on different cell lysate using anti-CASK antibody at 1/500 dilution.Positive control:Lane1: SiHaLane2: A549
Immunocytochemistry/Immunofluorescence: CASK Antibody [NBP2-76922] - ICC staining CASK in SiHa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: CASK Antibody [NBP2-76922] - Immunohistochemical analysis of paraffin-embedded human placenta tissue using anti-CASK antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CDC7 Antibody
NBP2-32708
Immunocytochemistry/Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle. Antibody stainng is shown in green.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human stomach, upper shows moderate nuclear and cytoplasmic positivity in glandular cells.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DBF4 Antibody (6G9)
H00010926-M01
Western Blot: DBF4 Antibody (6G9) [H00010926-M01] - Analysis of DBF4 expression in transfected 293T cell line by DBF4 monoclonal antibody (M01), clone 6G9.Lane 1: DBF4 transfected lysate(76.9 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: DBF4 Antibody (6G9) [H00010926-M01] - Analysis of monoclonal antibody to DBF4 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: DBF4 Antibody (6G9) [H00010926-M01] - Immunoperoxidase of monoclonal antibody to DBF4 ( Cat # H00010926-M01 ) on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
DTD1 Antibody
NBP1-88776
Western Blot: DTD1 Antibody [NBP1-88776] - Analysis in control (vector only transfected HEK293T lysate) and DTD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DTD1 Antibody [NBP1-88776] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: WB, IHC, IHC-P
MCM7 Antibody (6C2)
H00004176-M01
Western Blot: MCM7 Antibody (6C2) [H00004176-M01] - MCM7 monoclonal antibody (M01), clone 6C2 Analysis of MCM7 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: MCM7 Antibody (6C2) [H00004176-M01] - Analysis of monoclonal antibody to MCM7 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: MCM7 Antibody (6C2) [H00004176-M01] - Analysis of monoclonal antibody to MCM7 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. Antibody concentration 3 ug/ml.
(5 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
BRCA1 Antibody
(6B4)
NB100-404
Western Blot: BRCA1 Antibody (6B4) [NB100-404] - Assay was performed using MCF7 (human) and MEF(mouse embryonic fibroblast) cell lysate separated in a 5-15% gradient gel. Observed molecular weight of BRCA1: 220 KD. Predicted molecular weight of BRCA1: 220 KD. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: BRCA1 Antibody (6B4) [NB100-404] - Staining of BRCA1 nuclear foci induced by ionizing radiation. IR-treated (2 hr /4 gray IR) U2OS cells were pre-extracted with CSK buffer on ice for 4 min before fixation with 4% PFA in room temperature, and then subjected to immunostaining. DAPI was used to counterstain nucleus. 6B4 was used. Secondary antibody (Alexa Fluor-488) used for detection of primary antibody (BRCA1 antibody 6B4)
Immunohistochemistry: BRCA1 Antibody (6B4) [NB100-404]
(5 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
GEMC1 Antibody
NBP2-41131
Western Blot: GEMC1 Antibody [NBP2-41131] - Western blot analysis of GEMC1 in mouse heart tissue lysate with GEMC1 antibody at 1 ug/mL in (A) the absence and (B) the presence of blocking peptide
Species: Hu, Mu
Applications: WB, ELISA
RECQL4 Antibody
NBP2-47310
Western Blot: RECQL4 Antibody [NBP2-47310] - Analysis in human cell line U-2 OS.
Immunocytochemistry/Immunofluorescence: RECQL4 Antibody [NBP2-47310] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RECQL4 Antibody [NBP2-47310] - Staining of human thyroid gland shows distinct nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDK2 Antibody
(OTI2D9)
NBP2-00776
Western Blot: Cdk2 Antibody (2D9) [NBP2-00776] Analysis of extracts (35ug) from 9 different cell lines by using anti-Cdk2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cdk2.
Immunohistochemistry-Paraffin: Cdk2 Antibody (2D9) [NBP2-00776] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-Cdk2 mouse monoclonal antibody.
(1 Review)
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MCM2 Antibody
NB100-288
Western Blot: MCM2 Antibody [NB100-288] - Detection of human and mouse MCM2 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-MCM2 antibody NB100-288 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry: MCM2 Antibody [NB100-288] - Sample: FFPE section of human small cell lung cancer. Antibody: Affinity purified rabbit anti-MCM2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MCM2 Antibody [NB100-288] - Detection of human MCM2 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HEK293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MCM2 antibody NB100-288 used for IP at 3 ug per reaction. MCM2 was also immunoprecipitated by rabbit anti-Phospho MCM2 (S108) antibody NB100-639. For blotting immunoprecipitated MCM2, NB100-288 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Chk1 Antibody
NB100-464
Western Blot: Chk1 Antibody [NB100-464] - Knockout of ORC2 in HCT116 p53-/- cells. Western blot of ORC2 in HBEC and 293T cell lines. Ponceau S staining of total protein or immunoblot of Chk1 show equal loading of the pairs of lanes. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/19084), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Chk1 Antibody [NB100-464] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-CHK1 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Chk1 Antibody [NB100-464] - Detection of Human Chk1 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, and mouse TMCK cells. Antibodies: Affinity purified rabbit anti-Chk1 antibody NB100-464 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(8 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
XPC Antibody (3.26)
NB100-477
Western Blot: XPC Antibody (3.26) [NB100-477] - DNA repair protein expression in tumors. A. Western blot determination of p53, XPC, XPA, ERCC1 and MSH2 in tumors. GAPDH is loading control. Image collected and cropped by CiteAb from the following publication (//ovarianresearch.biomedcentral.com/articles/10.1186/1757-2215-4-9) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: XPC Antibody (3.26) [NB100-477] - Left: HeLa cells stained with XPC (3.26) monoclonal antibody (NB100-477). Right: DAPI Staining Photo is kindly provided by Dr. S. Liu at U of Arizona.
Western Blot: XPC Antibody (3.26) [NB100-477] - HeLa whole cell lysate detected using rabbit polyclonal.
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Cyclin E1 Antibody
[Unconjugated]
AF6810
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and HEK293 human embryonic kidney cell line. Gels were loaded with 25 µg of cytoplasmic (Cyto) and 25 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Cyclin E1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6810) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Cyclin E1 at approximately 50 - 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Cyclin E1 was detected in immersion fixed paraffin-embedded sections of human breast using Sheep Anti-Human Cyclin E1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6810) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclin E1 at approximately 64 kDa (as indicated) using 50 µg/mL of Sheep Anti-Human Cyclin E1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6810) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
Species: Hu
Applications: WB, Simple Western, IHC
ATM Antibody (2C1)
NB100-309
Western Blot: ATM Antibody (2C1) [NB100-309] - HeLa whole cell and nuclear extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:1000. Theoretical molecular weight 351 kDa.
Immunohistochemistry-Paraffin: ATM Antibody (2C1) [NB100-309] - Human Testis (formalin-fixed, paraffin-embedded) stained with ATM antibody (2C1) [NB100-309] at 5 ug/ml followed by biotinylated anti-mouse IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Western Blot: ATM Antibody (2C1) [NB100-309] - Detection of human ATM protein using ATM antibody (2C1) [NB100-309] by western blot or immunoprecipitation. Theoretical molecular weight 351 kDa.
(3 Reviews)
(120 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
PSF2 Antibody
NBP2-33825
Western Blot: PSF2 Antibody [NBP2-33825] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-GINS2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: PSF2 Antibody [NBP2-33825] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PSF2 Antibody [NBP2-33825] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
TICRR Antibody
NBP2-58491
TICRR Antibody
Species: Hu
Applications: ICC/IF

Publications for TICRR Antibody (NBP2-58491) (0)

There are no publications for TICRR Antibody (NBP2-58491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TICRR Antibody (NBP2-58491) (0)

There are no reviews for TICRR Antibody (NBP2-58491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TICRR Antibody (NBP2-58491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TICRR Products

Array NBP2-58491

Bioinformatics Tool for TICRR Antibody (NBP2-58491)

Discover related pathways, diseases and genes to TICRR Antibody (NBP2-58491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TICRR Antibody (NBP2-58491)

Discover more about diseases related to TICRR Antibody (NBP2-58491).
 

Pathways for TICRR Antibody (NBP2-58491)

View related products by pathway.

PTMs for TICRR Antibody (NBP2-58491)

Learn more about PTMs related to TICRR Antibody (NBP2-58491).

Blogs on TICRR

There are no specific blogs for TICRR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TICRR Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TICRR