DTD1 Antibody

Images

 
Western Blot: DTD1 Antibody [NBP1-88776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: DTD1 Antibody [NBP1-88776] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: DTD1 Antibody [NBP1-88776] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTD1 Protein (NBP1-88776PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DTD1 Antibody

  • bA379J5.3
  • bA555E18.1
  • C20orf88HARS2
  • chromosome 20 open reading frame 88
  • DNA-unwinding element-binding protein
  • D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae)
  • D-tyrosyl-tRNA(Tyr) deacylase 1
  • DUEB
  • EC 3.1
  • Histidyl-tRNA synthase-related
  • histidyl-tRNA synthetase 2
  • MGC119131
  • MGC41905
  • pqn-68

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46175
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-217
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-06099
Species: Hu
NBP2-20387
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-89428
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24600
Species: Hu, Mu
Applications: WB
NBP2-55065
Species: Hu
Applications: ICC/IF
NBP2-48797
Species: Hu
Applications: IHC
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2256
Species: Hu
Applications: WB, IHC-P, IP
25470002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P

Publications for DTD1 Antibody (NBP1-88776) (0)

There are no publications for DTD1 Antibody (NBP1-88776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTD1 Antibody (NBP1-88776) (0)

There are no reviews for DTD1 Antibody (NBP1-88776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DTD1 Antibody (NBP1-88776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTD1 Products

Bioinformatics Tool for DTD1 Antibody (NBP1-88776)

Discover related pathways, diseases and genes to DTD1 Antibody (NBP1-88776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTD1 Antibody (NBP1-88776)

Discover more about diseases related to DTD1 Antibody (NBP1-88776).
 

Pathways for DTD1 Antibody (NBP1-88776)

View related products by pathway.

PTMs for DTD1 Antibody (NBP1-88776)

Learn more about PTMs related to DTD1 Antibody (NBP1-88776).

Blogs on DTD1

There are no specific blogs for DTD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTD1