TIA1 Antibody [mFluor Violet 450 SE]

Product Discontinued

TIA1 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 287-386 of human TIA1 (NP_071505.2).
  
  Sequence:
  IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for TIA1 Antibody [mFluor Violet 450 SE]

• cytotoxic granule-associated RNA-binding protein
• nucleolysin TIA-1 isoform p40
• p40-TIA-1 (containing p15-TIA-1)
• p40-TIA-1
• RNA-binding protein TIA-1
• T-cell-restricted intracellular antigen-1
• TIA1 cytotoxic granule-associated RNA binding protein
• TIA1 cytotoxic granule-associated RNA-binding protein
• TIA-1

Background

The product encoded by this gene is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognizes poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15-kDa protein that is thought to be derived from the carboxyl terminus of the 40-kDa product by proteolytic processing. Alternative splicing resulting in different isoforms of this gene product has been described in the literature.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIA1