Thyroid receptor-interacting protein 12 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining in human testis and pancreas tissues using anti-TRIP12 antibody. Corresponding TRIP12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Analysis in human testis and liver tissues. Corresponding Thyroid receptor-interacting protein 12 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 12 Antibody [NBP2-34035] - Staining of human Fallopian tube shows weak nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thyroid receptor-interacting protein 12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AMCKEIIPTSEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIP12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Thyroid receptor-interacting protein 12 Protein (NBP2-34035PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Thyroid receptor-interacting protein 12 Antibody - BSA Free

• EC 6.3.2.-
• KIAA0045ULF
• MGC138849
• MGC138850
• probable E3 ubiquitin-protein ligase TRIP12
• thyroid hormone receptor interactor 12
• thyroid receptor interacting protein 12
• Thyroid receptor-interacting protein 12
• TR-interacting protein 12
• TRIP-12

Background

TRIP12 (thyroid hormone receptor interactor 12) was originally identified as a factor that interacts with the thyroid hormone receptor. It was later found to also interact with AAP-BP1, a component of the NEDD8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIP12
• Uniprot:
  • Q14669(Human)