Novus Biologicals products are now on bio-techne.com

Thyroid Peroxidase Recombinant Protein Antigen

Images

 
There are currently no images for Thyroid Peroxidase Protein (NBP1-80670PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thyroid Peroxidase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPO.

Source: E. coli

Amino Acid Sequence: RELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TPO
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80670.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thyroid Peroxidase Recombinant Protein Antigen

  • EC 1.11.1
  • MSA
  • TDH2A
  • thyroid microsomal antigen
  • thyroid peroxidase
  • thyroperoxidase
  • TPXEC 1.11.1.8

Background

Thyroid Peroxidase encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional splice variants have been described but their biological natures have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
288-TPN/CF
Species: Hu
Applications: BA
AF1016
Species: Hu
Applications: Neut, WB
255-SC
Species: Hu
Applications: BA
203-IL
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
AF4117
Species: Rt
Applications: IHC, WB
MEP00B
Species: Mu
Applications: ELISA
MAB6534
Species: Hu
Applications: ELISA, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
308-FK
Species: Hu
Applications: BA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D1100
Species: Hu
Applications: ELISA
NBP3-07388
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
DTM100
Species: Hu
Applications: ELISA
NB110-61574
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-80670PEP
Species: Hu
Applications: AC

Publications for Thyroid Peroxidase Protein (NBP1-80670PEP) (0)

There are no publications for Thyroid Peroxidase Protein (NBP1-80670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroid Peroxidase Protein (NBP1-80670PEP) (0)

There are no reviews for Thyroid Peroxidase Protein (NBP1-80670PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thyroid Peroxidase Protein (NBP1-80670PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thyroid Peroxidase Products

Research Areas for Thyroid Peroxidase Protein (NBP1-80670PEP)

Find related products by research area.

Blogs on Thyroid Peroxidase

There are no specific blogs for Thyroid Peroxidase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thyroid Peroxidase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TPO