THUMPD2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
THUMPD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for THUMPD2 Antibody - BSA Free
Background
THUMPD2 is a gene that codes for a protein expressed in a variety of tissues including the brain, colon, and kidney that has two isoforms, measuring 503 and 303 amino acids in length, with weights of approximately 56 and 34 kDa respectively. Current studies are being done on diseases and disorders related to this gene including tuberculosis. THUMPD2 has also been shown to have interactions with UBC.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, , WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm
Applications: KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Publications for THUMPD2 Antibody (NBP1-92504) (0)
There are no publications for THUMPD2 Antibody (NBP1-92504).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for THUMPD2 Antibody (NBP1-92504) (0)
There are no reviews for THUMPD2 Antibody (NBP1-92504).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for THUMPD2 Antibody (NBP1-92504) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional THUMPD2 Products
Research Areas for THUMPD2 Antibody (NBP1-92504)
Find related products by research area.
|
Blogs on THUMPD2