THNSL2 Antibody

Images

 
Western Blot: THNSL2 Antibody [NBP1-70723] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

THNSL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to THNSL2(threonine synthase-like 2 (S. cerevisiae)) The peptide sequence was selected from the middle region of THNSL2. Peptide sequence LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (93%), Rabbit (93%), Guinea Pig (92%), Bovine (93%), Canine (92%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THNSL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against THNSL2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for THNSL2 Antibody

  • FLJ10916
  • FLJ35504
  • secreted osteoclastogenic factor of activated T cells
  • SOFAT
  • THNSL2
  • threonine synthase-like 2 (S. cerevisiae)
  • THS2
  • TSH2

Background

THNSL2 acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates.THNSL2 dDegrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7270-IL/CF
Species: Hu
H00151056-B01P
Species: Hu, Mu
Applications: WB
NBP1-92090
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Ch, Pm
Applications: WB, IB, IHC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31344
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40415
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP2-15356
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-90235
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P

Publications for THNSL2 Antibody (NBP1-70723) (0)

There are no publications for THNSL2 Antibody (NBP1-70723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THNSL2 Antibody (NBP1-70723) (0)

There are no reviews for THNSL2 Antibody (NBP1-70723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THNSL2 Antibody (NBP1-70723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional THNSL2 Products

Bioinformatics Tool for THNSL2 Antibody (NBP1-70723)

Discover related pathways, diseases and genes to THNSL2 Antibody (NBP1-70723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THNSL2 Antibody (NBP1-70723)

Discover more about diseases related to THNSL2 Antibody (NBP1-70723).

Blogs on THNSL2

There are no specific blogs for THNSL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our THNSL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THNSL2