Granzyme M Antibody

Images

 
Immunohistochemistry: Granzyme M Antibody [NBP2-14079] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Granzyme M Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPP VATAVAPYVSWIRKVTGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GZMM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Granzyme M Protein (NBP2-14079PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Granzyme M Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • granzyme M (lymphocyte met-ase 1)
  • granzyme M
  • Hu-Met-1
  • LMET1
  • lymphocyte met-ase 1
  • Met-1 serine protease
  • MET1met-ase
  • Met-ase
  • Natural killer cell granular protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81245
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-58965
Species: Hu
Applications: WB, PEP-ELISA
AF2200
Species: Hu
Applications: WB, IP
NBP2-14079
Species: Hu
Applications: IHC, IHC-P

Publications for Granzyme M Antibody (NBP2-14079) (0)

There are no publications for Granzyme M Antibody (NBP2-14079).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme M Antibody (NBP2-14079) (0)

There are no reviews for Granzyme M Antibody (NBP2-14079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Granzyme M Antibody (NBP2-14079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Granzyme M Products

Bioinformatics Tool for Granzyme M Antibody (NBP2-14079)

Discover related pathways, diseases and genes to Granzyme M Antibody (NBP2-14079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme M Antibody (NBP2-14079)

Discover more about diseases related to Granzyme M Antibody (NBP2-14079).
 

Pathways for Granzyme M Antibody (NBP2-14079)

View related products by pathway.

PTMs for Granzyme M Antibody (NBP2-14079)

Learn more about PTMs related to Granzyme M Antibody (NBP2-14079).
 

Research Areas for Granzyme M Antibody (NBP2-14079)

Find related products by research area.

Blogs on Granzyme M

There are no specific blogs for Granzyme M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Granzyme M Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMM